KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0172Help
Entry
TepiRe1_0172      CDS       T02434                                 

Definition
Alkaline phosphatase (fragment) (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TepiRe1_0172
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TepiRe1_0172
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TepiRe1_0172
Enzymes [BR:tae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TepiRe1_0172
Exosome [BR:tae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TepiRe1_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177647..178420)
Genome map
AA seq 257 aa AA seqDB search
MTGFAKKRLISLVLALVFLLSMVGTVSAQQLAIPQMPAEQKQVKNLIMMIPDGMGLPHVT
LARWYKGGELFTMDQMACGLVRTYASDSAITDSAPAATVMATGYKSHTGFIGTLPDIANM
PGLDPIKPGEERRPVATILEAAKLKGLATGLVATSQIPHATPAGFSAHYPNRNKYELLIE
QQVYNNIDVVFGGGYQYLEKREDKENLISALKNRGYEYITERDELLTTKGDKVWGMFAPV
DLAYDFDRPEHEPTLAK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactggttttgctaaaaaacgtttaatttcattggtgttagctctggttttcttatta
tcaatggttggaaccgtttcggcccaacagttagctatcccgcaaatgcccgcagaacaa
aaacaagttaaaaacttaatcatgatgattccggatggaatgggtcttcctcatgtaacc
cttgcacgatggtataagggcggagaactttttactatggaccaaatggcctgcggcctg
gtaagaacctatgcttccgattcggctataacagactcagctccggcagctacggtaatg
gctacaggttacaaatctcacaccggatttataggcacgcttccagacatagctaatatg
cccggccttgatccaatcaagcctggagaagaaaggcgccctgtggctactatactagaa
gccgccaaactaaaaggtcttgccaccggccttgtagcgacttctcaaattccgcatgcc
actcctgcaggcttttccgctcattatcccaatcgcaacaagtatgagctgcttatagaa
cagcaggtatacaataatatcgatgtagtttttggcggaggctatcaatatctagaaaaa
cgtgaagacaaagaaaatcttatatcagctctaaaaaataggggttatgagtatataacc
gaaagagatgaacttttaacaacaaaaggcgacaaagtatggggcatgtttgctcctgta
gacttggcctatgactttgacaggccggaacatgaaccgactttagcgaaatga

DBGET integrated database retrieval system