KEGG   Thermosipho africanus: THA_1014Help
Entry
THA_1014          CDS       T00797                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
taf  Thermosipho africanus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THA_1014
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THA_1014
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THA_1014
Enzymes [BR:taf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THA_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1039509..1040771)
Genome map
AA seq 420 aa AA seqDB search
MREFVNLKFEEMPKVWYNVLSDLPFKLDPPLDPETNKPMSPEKLLKIFPAPLLEQEVNDT
DKFIDIPEEILKEYAVYRPTPLIRANFLEEYLQTPAKIYYKYEGQSPTGSHKTNTALAQA
YYNKISGVKKLYTETGAGQWGSALSYSGLKFGINVNIYMVRVSFNQKPARKSIMKLFNGK
VTPSPSRNTKSGRKYEENHPGSLGIAISEAMEEVLQRNDSKYALGSVLNHVLLHQTIIGL
EIKKQLEKLNIQPDVIIGCHGGGSNFGGTILPFIPDKLSGKNIRFIACEPESCPTLTKGE
YRYDFGDTAGFTPLLKMYTLGKDFIPPSIHAGGLRYHGAAPIISALLNHNLIEAKAFSQE
ETFKAARLFSKLEGIIPAPESSHAIAGAIKEALNAKKENKEKIIVFTLSGHGLFDLNAYI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttgtaaatttaaaatttgaggagatgcctaaagtatggtacaacgtttta
tcagatttacctttcaaattagatccacctcttgatccagaaacaaataaacctatgtct
cctgaaaagcttttaaaaatatttcctgcaccacttcttgaacaagaagtaaacgatact
gacaaatttattgatataccagaagaaatattaaaagaatatgcagtatacaggcctact
ccacttataagggcaaattttttagaagaataccttcaaacacctgcgaaaatatactat
aaatatgaaggtcaaagtccaacgggaagtcacaaaacaaacaccgcacttgcacaggca
tattacaacaaaatctcaggagtaaaaaaactttacacagaaacgggagctggacaatgg
ggaagtgctttatcatattctggattaaaatttggaataaatgtaaatatctatatggtt
cgcgttagctttaaccaaaaaccagcacgaaaaagtattatgaaactttttaacggtaaa
gtaactccctctcctagtagaaacacaaaatctggaagaaaatacgaagaaaatcatcct
ggaagccttggaattgcaataagcgaagctatggaagaagttttacaaagaaatgattca
aaatatgcacttggaagtgttctaaatcatgtacttctgcatcagacaattattggatta
gagataaaaaaacaacttgaaaaattaaatattcaaccagatgtaataataggatgccat
ggcggaggatcaaattttggcggaacaattcttccattcattccagataaattatctgga
aaaaatattagatttatcgcttgtgaacctgaaagttgtcctacattaacaaaaggagaa
tacagatatgactttggagatacagcagggtttactccacttttaaaaatgtatacactt
ggtaaagattttatcccaccatctatacatgcaggtggtttaagatatcatggagcagct
ccaataatttctgcacttttaaatcacaatctaatagaagcaaaagcgttttcccaagaa
gaaacatttaaagccgctcgattgttttcaaaacttgaaggtattattcctgctccagaa
tcttcacatgcaatagccggtgcaataaaagaagcattaaatgcaaaaaaagaaaataaa
gaaaaaataattgtattcacactttctggtcatgggttgtttgatttaaatgcatatata
taa

DBGET integrated database retrieval system