KEGG   Thermosipho africanus: THA_1053Help
Entry
THA_1053          CDS       T00797                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
taf  Thermosipho africanus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THA_1053
  Lipid metabolism
   00561 Glycerolipid metabolism
    THA_1053
   00600 Sphingolipid metabolism
    THA_1053
Enzymes [BR:taf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     THA_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1076246..1077772
Genome map
AA seq 508 aa AA seqDB search
MEIIKELKNGKIISKKIKGKPGKVKVFEEVLSDNYILINNWQSWGPTKVIPKDFKLNISK
EFLEKARFSPNPNPELLLDYIVSDYFIATKDKLYGFLSSKIGHPYFLIKDGKIEGYIDYF
EEEFEDYIETEPLAVLNGNIDILLREYGELLRDYNKPQFKDWNPVGWSSWYYYFENLTWD
DVLKNLKLAKNYPFEVFQIDDSWQKDIGDWQPKESFPSLKEMAGTIRKFGFVPGIWLAPF
SVSETSSIFKEHKDWLVKDDAGNPKVAYQNWGKNIYALDLSNPDVLDFIETLFKSLKDSG
FEYFKIDFLFAGAIPGKRYQNISPIRAYRLGMEKIRKTVSDNFILGCGAPLLPSIGYVDG
MRIGPDTAPYYDPKIPDNLGPNAYSALRNTITRYFMNKKLWLNDPDCLLLRKTETNLTTN
QKKMFAITAGMLDNMILVSDDLELELDDFLIPTALKLKGGEYFVEGIMDKAFTIYTKNEK
VGEVKFRICLETEKSEYYPDKDFLKGKK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattaaagaactcaaaaatggaaagataatatcaaagaaaatcaaaggaaag
cctggaaaagttaaagtatttgaggaagtattaagtgataattatattttgatcaataac
tggcaaagttggggaccaacaaaggttataccgaaggattttaagcttaatatttcaaaa
gaatttcttgaaaaagcaaggttttcaccaaatccaaatcctgaattattactagattat
attgttagtgactattttattgctacgaaagataaattatacggttttttgtcatcaaag
atcggccatccttattttttgataaaggatggaaaaatagaaggatatatcgattatttc
gaagaagagtttgaagattatattgagacagaaccactagctgttttaaatggaaatatt
gatatacttttgcgagagtacggagaactgcttagagattataacaaaccacaatttaaa
gattggaatcctgtaggttggtcaagttggtattattattttgaaaaccttacttgggat
gatgttttgaaaaatcttaaacttgctaagaattatccatttgaagtttttcaaatagat
gactcttggcaaaaagacataggagattggcagccaaaagaaagttttccatcattaaaa
gaaatggcagggactataaggaaatttggatttgttcctggaatatggcttgctccattt
agtgtatctgaaacttccagtatttttaaagagcataaagattggcttgtaaaggatgat
gctggcaatccaaaggtagcgtatcaaaattggggaaaaaatatctacgcacttgatctg
agtaatccagatgttttagattttattgaaactctttttaaaagtctaaaagattcagga
tttgaatattttaaaatagatttcttatttgcgggagcgatccctggaaagagatatcag
aatatatcacccattcgggcatatagacttggaatggaaaaaataaggaaaacggtaagt
gataatttcattcttggatgtggagctcctcttcttccgtcaatcggttatgttgatgga
atgagaattggtcctgatacagcaccttattatgatccaaaaattccagataacttgggg
ccaaatgcatatagcgcgcttcgtaatacaataacaaggtattttatgaacaaaaaactt
tggttgaatgatccagattgtttgcttcttagaaaaacagagacgaatcttacaacaaat
caaaaaaagatgtttgcaataactgcagggatgcttgataacatgattcttgtaagtgat
gatctagaacttgaactagatgattttctcattccgacagctttaaaattaaaaggtgga
gaatattttgtagaaggcattatggacaaggcttttactatttatacaaaaaatgaaaag
gttggagaagttaaatttagaatttgtcttgaaacagaaaaatctgagtattatccagat
aaagatttcttaaagggtaaaaaataa

DBGET integrated database retrieval system