KEGG   Thermosipho africanus: THA_1059Help
Entry
THA_1059          CDS       T00797                                 

Definition
beta-N-acetylglucosaminidase CbsA
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
taf  Thermosipho africanus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:taf00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:taf00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081112..1082446
Genome map
AA seq 444 aa AA seqDB search
MNDFGNLFFIGFQNQFEKDFLERINPCGIILYPENMNDVYKLQINMERIYSLFDKGYRFF
ISSDHEGGQLETVPNIFPSPGNMAIGKVGSASEFGNYLAHMLKLHGFNMVFAPVVDVKHE
KSSHVTGFRAYSDDHEIIKMRALEFIRSLLDENIAPTLKHFPGHGKAKEDSHFTLPVVFD
FDENDEDMMIFKELSKHVDFIMTAHVMYPKLDEVVATLSKKILKGILREKFGYKGLIISD
AFEMKALYKNYSPKEVIKRFFEADGDIILIGDVENHYYLIETFNSMVKSGELDIELLKEK
VEKIKKIKEKYVSDTYPTRFLSKIAKQAIDFKLDSPVENPSFLIPQAKNLSLADTSQKDL
KYLRNLIKEEFKDAKIYTSSSEISNEDTVIYFVLDKVENVNAKRVIYIFLRDVLKKDVEY
VNPYSSKLISIYHVLQLFKGEGLL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattttggtaatttattctttataggttttcaaaatcagtttgagaaagatttt
cttgaaagaattaacccatgtggaataattttgtatcctgagaatatgaatgatgtgtat
aaactacagattaacatggaaagaatatattcactctttgataaaggatatcgctttttt
atatcaagtgaccatgagggagggcaacttgaaacagttccaaatatatttccatcacct
ggaaatatggcaattggaaaagtgggtagtgcatccgaatttggaaactatcttgctcat
atgttaaagctgcatgggtttaatatggtctttgcacctgttgttgatgtaaaacatgaa
aaatcgagccatgttacaggatttagagcatattcagatgatcatgaaattataaagatg
cgtgcgctggagtttattagatcgcttttagatgaaaatatcgcccctactttaaaacat
tttccaggacatggaaaagcaaaagaggattcccacttcactcttccagtagtttttgat
tttgatgaaaatgatgaagatatgatgatatttaaagaactatcaaagcatgttgatttt
ataatgactgcacatgttatgtacccaaaattagatgaagtagttgccactctttcaaag
aagattttaaagggtatattaagggaaaaatttggatataaaggtttaataatttctgat
gcgtttgaaatgaaagctctctacaaaaattattcaccaaaagaagttataaaaagattc
tttgaagcagatggagacataatccttattggagatgttgaaaatcattattatctgata
gaaacctttaattccatggttaaaagtggagaattggatattgaacttttaaaagaaaag
gttgaaaaaataaagaagataaaagaaaaatatgtatcagacacttatcctacaaggttt
ttatctaaaattgcaaagcaagcaattgattttaaattagattctcctgttgaaaatcca
tcgtttttaatcccccaagcaaaaaatctcagccttgcagatacttcccagaaggatctt
aaatacctaagaaatttaataaaagaagagtttaaagacgcaaaaatttatacaagtagc
tcagaaattagtaatgaggatacagttatatattttgttttagacaaagttgaaaatgtt
aatgcaaagcgtgttatttatatttttttaagagatgtattgaaaaaagatgttgaatat
gtaaatccgtattcttcaaagcttatttcaatatatcatgttttacaactttttaaaggg
gaggggttactatga

DBGET integrated database retrieval system