KEGG   Thermosipho africanus: THA_1059Help
Entry
THA_1059          CDS       T00797                                 

Definition
beta-N-acetylglucosaminidase CbsA
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
taf  Thermosipho africanus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    THA_1059
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    THA_1059
Enzymes [BR:taf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     THA_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081112..1082446
Genome map
AA seq 444 aa AA seqDB search
MNDFGNLFFIGFQNQFEKDFLERINPCGIILYPENMNDVYKLQINMERIYSLFDKGYRFF
ISSDHEGGQLETVPNIFPSPGNMAIGKVGSASEFGNYLAHMLKLHGFNMVFAPVVDVKHE
KSSHVTGFRAYSDDHEIIKMRALEFIRSLLDENIAPTLKHFPGHGKAKEDSHFTLPVVFD
FDENDEDMMIFKELSKHVDFIMTAHVMYPKLDEVVATLSKKILKGILREKFGYKGLIISD
AFEMKALYKNYSPKEVIKRFFEADGDIILIGDVENHYYLIETFNSMVKSGELDIELLKEK
VEKIKKIKEKYVSDTYPTRFLSKIAKQAIDFKLDSPVENPSFLIPQAKNLSLADTSQKDL
KYLRNLIKEEFKDAKIYTSSSEISNEDTVIYFVLDKVENVNAKRVIYIFLRDVLKKDVEY
VNPYSSKLISIYHVLQLFKGEGLL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattttggtaatttattctttataggttttcaaaatcagtttgagaaagatttt
cttgaaagaattaacccatgtggaataattttgtatcctgagaatatgaatgatgtgtat
aaactacagattaacatggaaagaatatattcactctttgataaaggatatcgctttttt
atatcaagtgaccatgagggagggcaacttgaaacagttccaaatatatttccatcacct
ggaaatatggcaattggaaaagtgggtagtgcatccgaatttggaaactatcttgctcat
atgttaaagctgcatgggtttaatatggtctttgcacctgttgttgatgtaaaacatgaa
aaatcgagccatgttacaggatttagagcatattcagatgatcatgaaattataaagatg
cgtgcgctggagtttattagatcgcttttagatgaaaatatcgcccctactttaaaacat
tttccaggacatggaaaagcaaaagaggattcccacttcactcttccagtagtttttgat
tttgatgaaaatgatgaagatatgatgatatttaaagaactatcaaagcatgttgatttt
ataatgactgcacatgttatgtacccaaaattagatgaagtagttgccactctttcaaag
aagattttaaagggtatattaagggaaaaatttggatataaaggtttaataatttctgat
gcgtttgaaatgaaagctctctacaaaaattattcaccaaaagaagttataaaaagattc
tttgaagcagatggagacataatccttattggagatgttgaaaatcattattatctgata
gaaacctttaattccatggttaaaagtggagaattggatattgaacttttaaaagaaaag
gttgaaaaaataaagaagataaaagaaaaatatgtatcagacacttatcctacaaggttt
ttatctaaaattgcaaagcaagcaattgattttaaattagattctcctgttgaaaatcca
tcgtttttaatcccccaagcaaaaaatctcagccttgcagatacttcccagaaggatctt
aaatacctaagaaatttaataaaagaagagtttaaagacgcaaaaatttatacaagtagc
tcagaaattagtaatgaggatacagttatatattttgttttagacaaagttgaaaatgtt
aatgcaaagcgtgttatttatatttttttaagagatgtattgaaaaaagatgttgaatat
gtaaatccgtattcttcaaagcttatttcaatatatcatgttttacaactttttaaaggg
gaggggttactatga

DBGET integrated database retrieval system