KEGG   Thermosipho africanus: THA_1078Help
Entry
THA_1078          CDS       T00797                                 

Definition
(GenBank) uroporphyrinogen III synthase/methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
taf  Thermosipho africanus
Pathway
taf00860  Porphyrin and chlorophyll metabolism
taf01100  Metabolic pathways
taf01110  Biosynthesis of secondary metabolites
taf01120  Microbial metabolism in diverse environments
Module
taf_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THA_1078
Enzymes [BR:taf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     THA_1078
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     THA_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ACJ75534
UniProt: B7IHH0
Position
1097970..1099358
Genome map
AA seq 462 aa AA seqDB search
MGVVYLVGAGPGDLKLITLKGLEVLKKADCVVYDHLINPNLLNFAKDDAKLIYVGKVAGN
HSKTQEQINKILEDEARKANVVVRLKGGDPFVFGRGGEEFDYLTQRGIKVEIIPGITSAI
AAPAYAGIPVTQRGISSHFHVYTGHSKDTKIYEDSGTIVFLMVSKNIDFVKEKLLEKFLP
DTPCAVINNGTTNLQKTYLTSIKDLEERLFDSPSLLVVGNVVKKRINWFEGGKLFRKKIL
ITTQYSKDFEILEKSGAQLYFVPTFYIKENVEKLEYLAKNLDKYETLIFTSKNGVRLFLK
WLKKFKIDLRGLKAEIAVIGEKTAKEFEKVGVFADIIPEKELSEKLFEMIDKRKKAAYIT
STLGKNINEENIEKIEVYQTIENYRMKRVLNEVLKKEMDYVVFTSPSSFLFFLKMAKLNK
EKICAIGPVTKKCIEDHGYKVEIMPKKYTYEELCKEILKKGG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagtttaccttgttggtgccggacctggagatttgaaattaataactttaaaa
ggattagaagttttaaaaaaggccgattgtgtggtttatgatcatctgataaatcctaat
cttttaaattttgcaaaagatgatgcaaagcttatatatgtcggtaaagttgcaggaaat
cattccaaaactcaggagcagataaacaaaattttagaagacgaggcaagaaaggcaaat
gtggttgttaggttaaaaggtggagatccgtttgtatttggaagaggtggggaagaattt
gactatttaacgcaaagaggaattaaagtagaaataattccaggtataacttcagcaatt
gcagcaccagcttatgcaggaatacctgttacacaaagaggtatttcttcacactttcat
gtttatacaggacatagtaaagacacgaaaatttatgaagatagtggtactatagtgttt
ctaatggtttcaaaaaacatagattttgtaaaagaaaaacttcttgaaaagtttttacct
gacacaccttgtgcggttataaacaacggaacgacaaatctacaaaaaacttatctgaca
tcgattaaggatcttgaagaaagattatttgattcaccttcgcttttggttgttggtaat
gttgtaaagaagagaataaattggtttgaaggcggaaagttatttagaaagaaaatatta
attacaactcagtatagcaaggattttgaaattttagaaaaaagcggcgctcaactttat
tttgttccaaccttttatattaaagaaaatgtggaaaaacttgaataccttgcaaaaaat
ttggataaatatgagacattgatatttacaagtaaaaacggcgtacggctatttttaaag
tggctaaagaaattcaaaattgacttaagaggcctaaaagcagagatagcggtaattggt
gaaaagaccgcaaaagaatttgaaaaagttggcgtatttgctgatattatacctgaaaaa
gagctttctgaaaaattatttgaaatgattgataaaagaaaaaaggcagcatatataacg
tcgactttggggaagaatataaatgaggaaaacatagaaaagattgaggtttatcaaaca
attgagaactatagaatgaagagggttctaaatgaagtattaaaaaaagaaatggattat
gttgtttttacaagcccatcatcatttttattctttcttaaaatggcaaaacttaataaa
gaaaagatatgtgcgatagggcctgttactaaaaaatgtatagaagatcatgggtacaaa
gttgaaataatgccaaaaaaatacacttatgaagaactttgcaaggaaatattgaaaaag
ggagggtag

DBGET integrated database retrieval system