KEGG   Thermosipho africanus: THA_1078Help
Entry
THA_1078          CDS       T00797                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
taf  Thermosipho africanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:taf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097970..1099358
Genome map
AA seq 462 aa AA seqDB search
MGVVYLVGAGPGDLKLITLKGLEVLKKADCVVYDHLINPNLLNFAKDDAKLIYVGKVAGN
HSKTQEQINKILEDEARKANVVVRLKGGDPFVFGRGGEEFDYLTQRGIKVEIIPGITSAI
AAPAYAGIPVTQRGISSHFHVYTGHSKDTKIYEDSGTIVFLMVSKNIDFVKEKLLEKFLP
DTPCAVINNGTTNLQKTYLTSIKDLEERLFDSPSLLVVGNVVKKRINWFEGGKLFRKKIL
ITTQYSKDFEILEKSGAQLYFVPTFYIKENVEKLEYLAKNLDKYETLIFTSKNGVRLFLK
WLKKFKIDLRGLKAEIAVIGEKTAKEFEKVGVFADIIPEKELSEKLFEMIDKRKKAAYIT
STLGKNINEENIEKIEVYQTIENYRMKRVLNEVLKKEMDYVVFTSPSSFLFFLKMAKLNK
EKICAIGPVTKKCIEDHGYKVEIMPKKYTYEELCKEILKKGG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagtttaccttgttggtgccggacctggagatttgaaattaataactttaaaa
ggattagaagttttaaaaaaggccgattgtgtggtttatgatcatctgataaatcctaat
cttttaaattttgcaaaagatgatgcaaagcttatatatgtcggtaaagttgcaggaaat
cattccaaaactcaggagcagataaacaaaattttagaagacgaggcaagaaaggcaaat
gtggttgttaggttaaaaggtggagatccgtttgtatttggaagaggtggggaagaattt
gactatttaacgcaaagaggaattaaagtagaaataattccaggtataacttcagcaatt
gcagcaccagcttatgcaggaatacctgttacacaaagaggtatttcttcacactttcat
gtttatacaggacatagtaaagacacgaaaatttatgaagatagtggtactatagtgttt
ctaatggtttcaaaaaacatagattttgtaaaagaaaaacttcttgaaaagtttttacct
gacacaccttgtgcggttataaacaacggaacgacaaatctacaaaaaacttatctgaca
tcgattaaggatcttgaagaaagattatttgattcaccttcgcttttggttgttggtaat
gttgtaaagaagagaataaattggtttgaaggcggaaagttatttagaaagaaaatatta
attacaactcagtatagcaaggattttgaaattttagaaaaaagcggcgctcaactttat
tttgttccaaccttttatattaaagaaaatgtggaaaaacttgaataccttgcaaaaaat
ttggataaatatgagacattgatatttacaagtaaaaacggcgtacggctatttttaaag
tggctaaagaaattcaaaattgacttaagaggcctaaaagcagagatagcggtaattggt
gaaaagaccgcaaaagaatttgaaaaagttggcgtatttgctgatattatacctgaaaaa
gagctttctgaaaaattatttgaaatgattgataaaagaaaaaaggcagcatatataacg
tcgactttggggaagaatataaatgaggaaaacatagaaaagattgaggtttatcaaaca
attgagaactatagaatgaagagggttctaaatgaagtattaaaaaaagaaatggattat
gttgtttttacaagcccatcatcatttttattctttcttaaaatggcaaaacttaataaa
gaaaagatatgtgcgatagggcctgttactaaaaaatgtatagaagatcatgggtacaaa
gttgaaataatgccaaaaaaatacacttatgaagaactttgcaaggaaatattgaaaaag
ggagggtag

DBGET integrated database retrieval system