KEGG   Thermosipho africanus: THA_1125Help
Entry
THA_1125          CDS       T00797                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
taf  Thermosipho africanus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:taf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1148808..1149638)
Genome map
AA seq 276 aa AA seqDB search
MKYSLKNGKEINFDHTYIMGIINVTPDSFYPGSRIDRDRLIDTVSQMIKDGAEIIDVGGE
STRPGAQEVSLEEELNRVVPAIEIIKNNFDIIVSVDTYKSKVAEESLKLGADIINDISAF
RFDENMVNIAKKYDCPVILMHMKGTPRNMQQNPFYEDTIGEIIKFLKERIEFSKKHGVEK
IIIDPGIGFGKRLIDNLLILKHIDEFKKLGYPVLVGASRKSMIGMILDLPVEERLEGTLA
ITAYSVMKDVDIIRVHDVKENYRVVKVIEAIKNAVG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactcactaaaaaatggaaaagaaattaattttgatcacacttatataatggga
ataattaatgtaactccagactctttttacccaggaagtagaattgatcgtgataggcta
attgatacagtctctcaaatgattaaggatggagcagaaataatagatgttggtggtgaa
agtacaaggcctggcgcacaagaagtatctttagaagaagaattaaacagggttgttcct
gcaatagagatcattaaaaataactttgatataattgtgtcagttgatacctacaaatca
aaggttgcagaggaaagtcttaaattaggtgctgatataataaatgatataagcgcgttt
aggttcgatgaaaacatggtaaatatagcaaaaaagtatgattgtccagtaatactaatg
cacatgaaaggaacaccaaggaatatgcaacaaaatcctttctacgaagacacaataggt
gaaataattaaattcttaaaagaaagaattgaattttcaaaaaaacacggagtagaaaaa
ataataatcgatccaggaattggttttggaaaaagattaatagataaccttttaatcctc
aaacatatcgatgaattcaaaaaacttggatatcctgttctagttggtgcaagtagaaaa
tctatgataggaatgatcttggaccttccagttgaagaaagactcgaaggaactttagcc
ataacagcatattcagttatgaaagatgtagatataataagagttcatgacgtaaaagaa
aattatagagtggtaaaagtaattgaggcgattaaaaatgcggttggataa

DBGET integrated database retrieval system