KEGG   Thermosipho africanus: THA_1166Help
Entry
THA_1166          CDS       T00797                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
taf  Thermosipho africanus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:taf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1193165..1193734
Genome map
AA seq 189 aa AA seqDB search
MIHALNGKVESIENGKVYVNVNDLIYEIIVGDTGDFEEYINRNVKIYTKMVVNDDGISLY
GFLEVIKLKLFEKLIGVNKLGPKSALKIISSNSVESVVSAIINEDVKALSSLPGIGPKTA
ERIVLELKDTIKELDVSINEKDRKVLEAIEALVTLGFNRNQAKKAVNKVAAKDDKLDDII
KKALRFLSR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgattcatgctttgaatggaaaagttgaaagtatagaaaatggtaaggtatatgtgaat
gtaaatgatttaatatatgaaataattgtaggagatacgggagattttgaggaatatata
aataggaatgtaaagatatatacaaaaatggttgtaaatgatgatggaataagtttgtat
ggctttttagaggttattaaactaaaactttttgaaaagttgattggtgtgaacaaactt
ggaccaaaaagtgctttaaagattatttcatcaaacagtgttgagtcagtcgtaagtgct
ataatcaatgaagatgtaaaggcactctcgagcctacctggaatagggccaaaaactgca
gagagaatagttttagaactaaaagatacaattaaagagttagatgtaagtattaatgaa
aaagataggaaagtcctagaagctatagaagcattggttactttgggatttaataggaat
caggctaaaaaggctgtaaataaagttgctgcaaaggacgataagttagatgatattatt
aaaaaggcgttgagatttttaagtaggtga

DBGET integrated database retrieval system