KEGG   Thermosipho africanus: THA_128Help
Entry
THA_128           CDS       T00797                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
taf  Thermosipho africanus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121527..122543
Genome map
AA seq 338 aa AA seqDB search
MIFITGGSGHLGNVLIRKLLKMGEQVVTLVHPSDKCESLKGLNVKIVKGDVRNYTLVEKL
SKNADIIIHLAALISILPWKKKAVYSVNIDGTKNILKVCKKLNKKLIYISSVHAFEEPKP
GTVIDENTNIDPSKTSGVYGKSKAFAALEVLNAIKSGLDITTVCPTGIIGPFDFKPSEMG
IMFLKYLTNKLKYIIDGSFDFVDVRDVADGIIKLIYLDKRANFYILSNKTFKMTELIHLL
NEITGKNIKPKVINTNFAYFLSLFSTTFGYLVNKKPLFTPYSIHTLTRNYTFSHEKATKE
INYNPRDIKITLYDTLEWLSNYFLKEKLINPLNLHSIK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatattcattactggtggttcaggacatttaggaaatgttcttatccgaaaactttta
aaaatgggggaacaagttgtaacacttgttcatccaagtgacaaatgtgaaagtttgaaa
ggattaaatgtaaaaatcgtaaaaggcgatgtaagaaattatacactagttgaaaaacta
tcaaaaaatgctgacataattattcatcttgctgcacttatatcaatacttccctggaag
aaaaaagctgtttactcagtaaatatagacgggactaaaaacatactaaaagtttgtaaa
aagttaaataaaaaactaatttatattagctcagttcacgcatttgaagagccaaagcct
ggaactgttatagatgaaaacactaatatcgatccttcaaaaacttctggagtatatggc
aaatcaaaagcatttgcagcacttgaagttcttaacgcaataaaatcaggcttagatatt
accaccgtatgcccaactggtattattggcccatttgattttaaaccatctgaaatgggg
ataatgtttttaaaatacttaaccaataaactcaaatacattattgatggaagttttgat
tttgtagatgtaagagacgttgcagatggaattattaaacttatttaccttgataaaaga
gctaatttttatatactttcaaacaaaacttttaaaatgactgaacttatacatctttta
aatgaaatcaccgggaaaaacataaaaccaaaagttataaatacaaattttgcatatttt
ttatcattattttcaacaacttttgggtatcttgtaaataaaaaaccactatttactcct
tactcaatacatacgttaacaagaaactatacattttcacatgaaaaagctacaaaagaa
ataaattataatccaagagatataaaaataactctttacgatacattggaatggctttca
aattactttttaaaagagaaattaataaatcctctcaatttgcactctatcaagtaa

DBGET integrated database retrieval system