KEGG   Thermosipho africanus: THA_129Help
Entry
THA_129           CDS       T00797                                 

Gene name
pfkB
Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_129 (pfkB)
   01230 Biosynthesis of amino acids
    THA_129 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_129 (pfkB)
   00030 Pentose phosphate pathway
    THA_129 (pfkB)
   00051 Fructose and mannose metabolism
    THA_129 (pfkB)
   00052 Galactose metabolism
    THA_129 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    THA_129 (pfkB)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_129 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(122508..123431)
Genome map
AA seq 307 aa AA seqDB search
MIFTLTMNPCLDRYIYVDDLKLDDTIRAKKVVDYPAGKGIDVSRVIKELGGISVAISLLG
GDTGRKIEEMLDMEGVIYTTIRVSVETRTNIILETNSGQFRISVPTKKVSRKKLETVLEV
LNAIVRKGDIIVISGSLPTGVSPDFYTGIIFALKQWGVYVYFDADGEKLKSGLLGGPDVI
KPNQHEFERLVGKKIEKFEDFIEQGKKLILEYNLKEILLTLGSKGALLLANDEGYFAKPI
DVPVNSAVGAGDSFLAAYVLMRDKGRYEAFKWANAAGNAAVMTPGTELCKKDDVLNLLDR
VQIERIY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatatttacacttacaatgaatccgtgccttgataggtatatttatgtagatgattta
aagcttgatgacacaatcagagcaaaaaaagtagtggattatcctgcaggaaaaggaata
gatgtatcaagggttattaaagagcttggtgggatttcagtagctatttctcttttaggt
ggtgatactggaagaaaaattgaagaaatgcttgatatggaaggcgttatatatacgacg
ataagggttagtgtagaaacaagaacaaatattattttagaaacaaatagtggacagttt
agaataagcgttccaactaaaaaagtttcgagaaaaaagctagaaacagttttagaagtt
ttaaatgctatagttagaaaaggagacataattgtaatttctggaagtcttccaactggt
gtttcacctgatttttacacaggaataatttttgctttaaaacaatggggagtatatgtt
tattttgatgcagatggtgaaaagttaaaatcagggttattgggtggtcctgatgtaata
aaacctaatcaacatgagtttgaaaggcttgttggtaagaaaatagaaaagtttgaagat
tttatagaacaaggtaaaaaattaattttggagtataatcttaaagaaatattactaact
ttaggatccaaaggagctttattattggcaaatgatgaaggatattttgctaaacctatt
gatgttccagtaaatagtgcagtaggggctggagattcatttttagcagcgtatgtttta
atgagagataaaggtagatatgaagcctttaagtgggcaaatgcagcaggaaatgcagcg
gttatgactcctggaaccgagctatgtaaaaaggacgatgttttaaatttacttgataga
gtgcaaattgagaggatttattaa

DBGET integrated database retrieval system