KEGG   Thermosipho africanus: THA_1446Help
Entry
THA_1446          CDS       T00797                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_1446
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_1446
   00052 Galactose metabolism
    THA_1446
   00500 Starch and sucrose metabolism
    THA_1446
   00520 Amino sugar and nucleotide sugar metabolism
    THA_1446
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THA_1446
   00524 Butirosin and neomycin biosynthesis
    THA_1446
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     THA_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1458639..1459571)
Genome map
AA seq 310 aa AA seqDB search
MNIVGVDLGGTYVKIGLVDSKNGKILKKSSIETKVELGGQEVVKRIANAILELTEGTDYH
AVGIGSPGSIDKENGIVRFSPNFPDWHNFPLGSLLSELLGKNVYVENDANSFALGEKWFG
AGIGKNHIVALTLGTGVGGGVISHGTLITGSTGIGAELGHVIINPNGPLCGCGNYGCLES
YASATAIVRMATERKKKFPDSIIFKNEKVTAKAVFDAARDGDRLALMLRDEVVEALAIGI
TGFVHIFNPEVVIIGGGVSRAGDILFEPLRKRVNELVMPTFKDTFEIIQSPLVENAGILG
AASIVLQREN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagtaggagtagacctcgggggaacatacgtaaaaattgggttggttgattcc
aaaaacgggaaaatattaaaaaaatcatcaattgaaacaaaagttgaactaggtggacaa
gaagttgttaaaaggattgcgaatgcaatattagaacttactgaaggaactgattatcac
gcagtaggtatcggctctccaggttcaatagacaaagaaaacggaattgttagattttct
cctaattttccagattggcataattttcccttaggctcacttctatcagaacttttgggt
aaaaacgtatacgttgaaaacgatgcaaattcatttgcgttaggagaaaaatggttcggt
gcaggaataggaaaaaatcatattgttgcattaacacttggaaccggtgttggtggtgga
gtaatttcacatggaactttaattacaggttctactggaataggtgcagaattaggtcac
gtgattataaatccaaatgggccgctttgtggttgtggaaactatggatgtctcgagtca
tacgcttctgcaacagcaattgtaaggatggcgacagaaaggaagaaaaaatttccagat
tcaataatatttaaaaatgaaaaagttacagctaaagcagtttttgacgcagcacgagac
ggtgatagacttgctttaatgctaagagatgaagttgttgaagcacttgctattggtata
acaggatttgttcatatttttaaccctgaagtagtcattattggtggtggtgtttcaagg
gctggagatatcttgtttgaaccacttagaaaaagagttaatgaacttgtaatgcctacc
tttaaagatacatttgaaataattcaaagcccattggttgaaaacgctggcatattgggg
gctgcttctattgttctccaaagagaaaactga

DBGET integrated database retrieval system