KEGG   Thermosipho africanus: THA_1451Help
Entry
THA_1451          CDS       T00797                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase ofgroup 2 operon
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
taf  Thermosipho africanus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:taf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:taf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1463743..1464294)
Genome map
AA seq 183 aa AA seqDB search
MEKVIIAGSAGSPNNVIKILKINQKLNIPILLCIHFSKNAIENFAHNIKNETGHEVIIVK
NPIKLKPAVYLAEGGKDLLLKTSEIVNSGIYKDTKTHPSIEVLLNSIAKLNDKNFHIFIL
GGLGNDGAKIAKTLEEKGIKFYIEKNPSFEYLTNNFLKNLKYHKILGLEEMKNEIIKINK
KRR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggttattattgcaggttctgctggaagccccaataatgttattaaaatactc
aaaataaatcaaaaattaaatattccaatattattgtgcattcacttttcaaaaaacgca
atagaaaattttgcacataatattaaaaatgaaactggtcatgaggttataatagtaaaa
aatccaataaaattaaaaccagctgtctatttagctgaaggtggtaaagatttattgctg
aaaacaagcgaaattgttaattcgggtatatataaagacacaaaaactcatccatcaatt
gaagtattgcttaattcaattgcaaaactgaacgataaaaactttcacatttttatcctt
ggtgggcttggaaatgatggtgccaaaatagctaaaacccttgaggaaaaaggtataaaa
ttttatatagaaaaaaatccctcttttgaatacctaacaaataattttttaaaaaactta
aagtatcacaaaatattaggtttagaagaaatgaaaaacgagatcattaaaattaacaaa
aaaagaaggtga

DBGET integrated database retrieval system