KEGG   Thermosipho africanus: THA_1510Help
Entry
THA_1510          CDS       T00797                                 

Definition
uridine kinase
Orthology
K00876  
uridine kinase [EC:2.7.1.48]
Organism
taf  Thermosipho africanus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:taf00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519049..1519663
Genome map
AA seq 204 aa AA seqDB search
MFIIGIGGGTGSGKTTVAQKINEIIGESNSVILPMDNYYKDMSHVPFEERKKYNYDHPDM
IEFSLLVDHLKELLDGKSIKLPEYDFAQYTRTGNFTLLDPKPVIIIEGIFALYYEELRKF
YDLSIFVDAESDVRFIRRLERDIKERGRTIDSVINQYLNMVKPMHDAYVEPSKKYADLII
PRGGFNEKAINVVVEFIFKKMSQN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttataattgggattggtggaggaacaggttcgggaaagacaactgtagctcagaag
ataaatgagattataggggagtcaaatagtgttattttgccaatggataactattataaa
gatatgagtcatgtgccttttgaagaaaggaaaaagtataattatgaccaccctgatatg
attgaattttctttgcttgtagatcatttaaaagaacttttggatggaaaaagcataaaa
ttgcccgagtatgattttgcacagtatactagaaccggaaattttacattattagatcca
aaaccggtgataataattgagggtatatttgcgttgtactacgaagaattaagaaagttt
tatgatctttccatttttgttgatgcagaaagtgatgtaaggtttataagaaggcttgaa
agagatataaaggagaggggaagaactatagatagtgtaataaatcaatacttaaacatg
gtaaaaccaatgcatgatgcatacgttgaaccaagtaaaaaatatgcagatttaataatt
ccacgtggtggttttaatgaaaaggcaattaatgtagttgttgaatttatatttaagaaa
atgtctcaaaattga

DBGET integrated database retrieval system