KEGG   Thermosipho africanus: THA_156Help
Entry
THA_156           CDS       T00797                                 

Definition
(GenBank) chain P, L-Fuculose-1-Phosphate Aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
taf  Thermosipho africanus
Pathway
taf00051  Fructose and mannose metabolism
taf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    THA_156
Enzymes [BR:taf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     THA_156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Ub-RnfH BssS
Motif
Other DBs
NCBI-ProteinID: ACJ74663
UniProt: B7IEZ9
Position
complement(153365..154003)
Genome map
AA seq 212 aa AA seqDB search
MKKKILEASKFIVENGLVKGTWGNISIRYEDKIYITPSGIPYDILTEDMISVVDLRGNHL
EGLKPSSELPTHLEIYRTREDVNAIVHTHPVFSTTVSLVADYIPPLIEDSVMILGSKILV
AEYALAGTEDLAINVVKALGNNNAVLLKNHGLITVGVDIKEALTASLVCEKTAEIYLYAL
NIGKFSTLSEEDAIMLRNKYLNSYRQIEKDVR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatattagaagcttcaaaatttattgttgaaaatggtttagtaaaaggc
acatggggtaatatatctataagatatgaagataaaatatatataaccccttctggtatt
ccttatgatatcttaactgaagatatgataagcgttgtagatttaagagggaatcatctt
gaaggtttaaagccttcatcagagcttccaactcatctagaaatttatagaactcgcgaa
gatgttaatgcaattgttcatacgcacccagttttttcaacaacagtttcattggttgca
gattatattcctccattaatagaggactctgttatgatattaggttcaaaaatattggta
gccgaatatgcacttgccggcaccgaagatttagccataaatgttgtaaaagcacttggt
aataataatgctgttttgctaaagaatcatggacttattaccgtaggtgtagatattaaa
gaagctttaactgcaagtttagtttgtgaaaaaacagctgaaatatatttatatgctttg
aatattggtaaattttcaacgcttagtgaagaggacgcgattatgcttaggaataagtat
ttgaatagttatagacagattgagaaagatgtaagataa

DBGET integrated database retrieval system