KEGG   Thermosipho africanus: THA_156Help
Entry
THA_156           CDS       T00797                                 

Definition
chain P, L-Fuculose-1-phosphate Aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
taf  Thermosipho africanus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:taf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(153365..154003)
Genome map
AA seq 212 aa AA seqDB search
MKKKILEASKFIVENGLVKGTWGNISIRYEDKIYITPSGIPYDILTEDMISVVDLRGNHL
EGLKPSSELPTHLEIYRTREDVNAIVHTHPVFSTTVSLVADYIPPLIEDSVMILGSKILV
AEYALAGTEDLAINVVKALGNNNAVLLKNHGLITVGVDIKEALTASLVCEKTAEIYLYAL
NIGKFSTLSEEDAIMLRNKYLNSYRQIEKDVR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatattagaagcttcaaaatttattgttgaaaatggtttagtaaaaggc
acatggggtaatatatctataagatatgaagataaaatatatataaccccttctggtatt
ccttatgatatcttaactgaagatatgataagcgttgtagatttaagagggaatcatctt
gaaggtttaaagccttcatcagagcttccaactcatctagaaatttatagaactcgcgaa
gatgttaatgcaattgttcatacgcacccagttttttcaacaacagtttcattggttgca
gattatattcctccattaatagaggactctgttatgatattaggttcaaaaatattggta
gccgaatatgcacttgccggcaccgaagatttagccataaatgttgtaaaagcacttggt
aataataatgctgttttgctaaagaatcatggacttattaccgtaggtgtagatattaaa
gaagctttaactgcaagtttagtttgtgaaaaaacagctgaaatatatttatatgctttg
aatattggtaaattttcaacgcttagtgaagaggacgcgattatgcttaggaataagtat
ttgaatagttatagacagattgagaaagatgtaagataa

DBGET integrated database retrieval system