KEGG   Thermosipho africanus: THA_1578Help
Entry
THA_1578          CDS       T00797                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
taf  Thermosipho africanus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THA_1578
  Lipid metabolism
   00600 Sphingolipid metabolism
    THA_1578
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    THA_1578
Enzymes [BR:taf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     THA_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583088..1586366
Genome map
AA seq 1092 aa AA seqDB search
MHVWENPKLVSKGLEKPHSAFIPYFNPFSGQFEYPNDYISLNGEWKIKIFNNPFEVLKEF
FSEDFNDNDWEEIEVPSNLEFTGKVKPIYTNVVYPFDIAPPYVPKDYNPTAVYRRKFFIP
QDWNDKEVFINFEGARSFLHLYINGKEVGFNKDSASHAEFKINDYIRIGENTISVEVLKW
CDGSYLEDQDMWWLSGIYRDVYIYALPKLYIKDIFIRTDLDDLYRDGKLFVDLKIMNNSN
LKDTNLKITLLDKFKDEKILIDSKYILSYGENDLNFSFDISKPLKWSHETPNLYVLKVEL
EEDQKKVNFGFRKVEKKNGTLTLNGRKLYIKGVNRHEFDPKRGHSITIERMIEDIKIMKQ
HNINTVRTSHYPNQTKWYDLCDYFGLLVIDEANIETHGIGWDPNVTLAEKEEWQEAHLDR
VRRMLERDKNHPSIIFWSLGNEAGTGINFEKASVLIKNRDNTRLVHFCGLGVDRLSDFYY
LDVASAMYPKVEDLLEYSSKKREKPYFMCEYSHAMGNSVGNLKDYWEIIESKPYLCGGCI
WDFVDQGIEKKDENGALFWAYGGDFGDNPNDKNFCCNGLLLPDRTPNPSLYEVKKVYQNV
EIMFLGDNRFLFKNKFMFTNLENYKGIWKLRKNGEVILEGEFRISLEPGDEKVEKINVPS
NFEENSEYYLDIYFVLENDERWAQKGHIVAYEQFKLKDPEYVMNKSFNGKLDFKEDGNKV
YILANDVEYIFSKTSGLLEQIIFNGKEILKEALKPNFWRAPTDNDIGNKMPERLKVWKKA
SYLRRLHDFKILKDYEKVVVLTTFEIPEYSWLSLTYIVFSNGDMLVDYYLKPSKDSVEIP
RIGMQAKLNKIFKHVEWYGLGPHETYSDRKNSGIVGIYLKEIDNMYHKYVRPQETGNRSD
VRWFSLKDESMNLNVIGYKNYVNFSVWPFSMEDLEKAEHINELKKRDFYTLNIDLAQMGV
GGDDSWGALPHKEYILWPKEYSYRFIINFSQNVKKEWINIPMIKENFEFYLNVPKSVKRD
TPFKIELFLKNNSPVTLKKDIFLTLENEIVYSKTFFIKPYSRVDETFELKIEKSGDYLLV
NNSGNIYKINVL
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtatgggaaaatccaaaacttgtttcaaaaggattagaaaaaccgcattcagca
tttataccatattttaatcccttttccgggcagtttgaatatccaaatgattatatttca
ttgaacggggaatggaaaataaaaattttcaataatccttttgaagttttaaaagagttt
ttttctgaagattttaacgataacgattgggaggaaatagaagtcccatcaaacttggaa
tttactggaaaagttaaaccaatttatacaaatgtggtttatccatttgacattgctcca
ccttatgttccaaaagattataacccaacagcagtttacagaaggaaattttttatacca
caagattggaatgataaagaagtatttattaattttgaaggtgcaagatcttttttacat
ctttacattaatggaaaagaagtgggctttaacaaagatagtgcatctcatgctgaattt
aaaataaacgattacattagaattggagaaaatacaatttcggtagaagttttaaaatgg
tgtgatggaagttatttggaagatcaagacatgtggtggctttctggtatttatagagat
gtatatatatatgcattaccaaagctgtatataaaagatatctttatcagaacagattta
gatgatttgtatagagacggtaagttatttgtggatttaaaaataatgaataactctaat
ttgaaagatacaaatttaaagataactcttttagataagtttaaagatgaaaaaatatta
attgattcgaaatatatcctaagttatggtgaaaacgacttgaatttttcttttgatata
tcaaaaccattgaagtggtcgcatgagacgccaaatttgtatgtattaaaagtagaatta
gaagaagatcaaaaaaaggtaaactttggctttagaaaagttgagaaaaaaaatggtact
ttaactttaaatggtagaaagttgtatataaaaggagtaaataggcatgaatttgatcct
aaaagaggtcattcaattacaattgaaagaatgattgaagatataaagataatgaagcaa
cataatataaatactgtgagaacttctcattatccaaatcagacaaagtggtatgattta
tgcgattatttcggtttattggttattgatgaagctaatatagaaactcatggaattggt
tgggatccaaatgtaacgcttgctgagaaagaagaatggcaagaagctcatcttgataga
gtaaggcgtatgctagaaagggataaaaatcatccgagtattattttttggtcactagga
aatgaagctggtacaggaataaactttgaaaaagcatcagtcttaattaaaaatagagat
aatactagattagttcatttttgtgggttaggtgttgatagactttcagatttttattat
cttgatgtggcgtcagcaatgtatcctaaagttgaagatttattagaatattcatctaaa
aaaagagaaaaaccatattttatgtgtgaatattctcatgctatggggaatagcgtaggc
aatttaaaagactattgggaaataattgaatcaaaaccatatttatgtggaggttgtatt
tgggattttgtagatcaaggtattgaaaaaaaagatgaaaatggagcacttttttgggcg
tatgggggagattttggagataatcctaacgataagaatttttgctgtaatggccttctt
ttgccagatagaactcccaatccttctttatatgaagtaaaaaaagtatatcagaatgtg
gaaataatgtttcttggtgataatagatttttatttaaaaacaaatttatgtttacaaat
ttggaaaattataaaggaatttggaaattaagaaaaaatggagaagttattttggaggga
gagtttagaatttctcttgaacctggagatgaaaaggttgaaaaaataaatgtaccaagt
aattttgaggaaaatagtgaatattatttggatatttattttgtccttgaaaatgatgaa
aggtgggctcaaaaaggtcacatagttgcatatgaacagtttaaattaaaagatccagaa
tatgtgatgaataaaagttttaatggaaaattagattttaaagaagatggcaataaagtt
tatattttagcaaatgacgtggaatatattttttcaaagacaagtggattgcttgaacaa
ataatttttaatggaaaagaaatattaaaagaggcacttaaaccaaatttctggcgagca
ccgacggataatgatattggtaataaaatgcctgaaagattaaaagtatggaaaaaagca
tcatatttgaggagattacatgatttcaaaattttaaaagattatgaaaaagtagtggta
ctgacaacttttgaaattccagagtactcatggctaagtttgacttatattgtattttcc
aatggtgatatgttagttgattattatttgaagccttctaaagattctgttgaaattcca
agaattggtatgcaagcaaaattgaataagatatttaaacatgtagaatggtatgggtta
ggtccccatgagacatatagtgatagaaaaaatagtggtattgttggaatatatttaaaa
gaaattgataatatgtatcataaatatgttagacctcaggaaactggtaatagaagtgat
gttagatggttctcacttaaagatgagagtatgaatttaaatgttataggttataaaaac
tacgttaattttagtgtttggcctttttcaatggaagatttagagaaagcagaacatata
aatgagttaaaaaagagggatttttatacattaaatatagatcttgcacaaatgggagtt
ggaggtgatgatagctggggtgcattaccgcataaagaatatattttgtggcctaaagaa
tatagttatagattcataattaacttttctcaaaatgtaaaaaaggaatggattaatata
ccaatgattaaagaaaattttgaattttatttaaacgttccaaaaagtgtaaaaagagat
actccatttaaaatagagttgttcttaaaaaataattcacctgtgaccttaaaaaaggat
atatttttgactttagaaaatgagatagtttattcaaaaacgttttttattaaaccctac
tcacgagtagatgaaacctttgaattaaaaatagaaaaaagtggagattatttattagta
aataattccggaaatatttataaaataaatgtactataa

DBGET integrated database retrieval system