KEGG   Thermosipho africanus: THA_158Help
Entry
THA_158           CDS       T00797                                 

Definition
holo-[acyl-carrier-protein] synthase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
taf  Thermosipho africanus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THA_158
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     THA_158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154281..155099)
Genome map
AA seq 272 aa AA seqDB search
MIVGLGNDIVEINRFDLKLVDRILTDIEKENKKLNAQYLAGRFSLKESFFKAIGTGISNN
SFKDISFLNNKNGKPYFVMHKDFKGFNFCHIALSHDKFANSMVVLEKIKGKIFLGLGSNI
GNREENLKKALEYIENFGINILRVSSIYITKPYGYLEQGDFFNIAVEVDSDLSPFELLNT
IMEIERIMKRKREIKWGPRNIDIDILFYGNLVVENENLKIPHYDFKNRDFFIAPMYEIAK
DFVDPIFDMSMNEYYSKLEKNWEVINWQMKKL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgattgtaggtttgggaaatgatattgtagagataaataggtttgatctaaaacttgtt
gatagaattttaacagatatagaaaaagagaacaaaaaattaaacgcccaatatcttgct
gggcgtttttctctaaaggaatcattttttaaagcaattggtactggaatatctaacaat
tcatttaaagatatttcttttttaaataacaaaaacgggaagccctattttgttatgcat
aaagattttaaaggatttaatttttgtcatattgcactttctcatgataagtttgcaaat
tctatggtagttcttgaaaaaattaaaggaaagatatttttaggccttggtagtaatata
ggaaatagagaagaaaatttaaagaaagccttagaatatatcgaaaactttggaataaac
attttaagagtttcaagtatatatataacaaaaccgtacggctatcttgagcagggcgat
ttttttaatatagcagtagaggttgactctgatttatctccatttgaattattaaataca
attatggaaatagaaaggataatgaagagaaaacgagaaataaagtggggaccgcgaaat
atagatattgatatattattttatggaaacttggttgtagaaaatgaaaatcttaagatt
cctcattatgatttcaaaaatagagattttttcatagctcccatgtatgaaattgcaaaa
gattttgtggatcctatttttgatatgagtatgaatgaatattactctaaacttgaaaaa
aattgggaggtaataaattggcagatgaagaaattataa

DBGET integrated database retrieval system