KEGG   Thermosipho africanus: THA_1582Help
Entry
THA_1582          CDS       T00797                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
taf  Thermosipho africanus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    THA_1582 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THA_1582 (pyrB)
Enzymes [BR:taf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     THA_1582 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589344..1590921)
Genome map
AA seq 525 aa AA seqDB search
MKNDFLGRSLTVIEDFSVDEQMFLYAQTRKLKKLWKEKSDISEFQIKKNVGIYIVFVEPS
TRTKESFINAARFHKNAKVNIFDSEHSSFNKKESYLDTFNMLTGYSDYSIFVLRTRLEGT
CKYLDEKVSEFAERHGVEKPAFINAGDGKHEHPTQELLDEYTFLEQMDFDNSFIHIALVG
DLLHGRTVHSKVNGLKIFKNVLVDLIAPEEISMPPHYIKKMKENGFEVRIFDSIESYLKS
TDKVAKIWYFTRLQLERMGEDILEKEHVLRKSVTFRKEFLEYIPQDVKFYHPLPRHKIYP
TIPTFLDNLPLNGWEQQAINGYWTRTVLLSMLGGALKANFDTSFNPQENDEDFIIPAPIV
NGTKGVSKEGKRGIKPIENGTVIDHIAKGKDKDKIFETIVKIRKILKLFDLDSADGIFKS
ENGEFKGYISLPNRYLSKKEIKMLSAISPNTTVNIIKNSRVVEKYRIFLPPFIYGFSELR
CKNENCITNPVNGENAEAFFIRNNEGELVCKYCETPHSFEEIWNI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgactttcttggaagaagtcttacagtgattgaagatttttcagttgatgaa
caaatgtttttgtatgctcaaactagaaagctaaaaaaactttggaaagaaaaaagtgac
atttctgaattccaaattaaaaagaacgtaggaatttacatcgtcttcgtagaacctagt
acaagaaccaaagaatctttcattaacgcagcaagattccacaaaaatgcaaaagtaaat
atttttgattcagaacattcatcttttaacaaaaaagaaagttatttagacacctttaac
atgttgacaggctatagtgactactcaatttttgttttaagaacaagacttgaagggaca
tgtaagtatttagatgaaaaagtatcagaatttgctgaaagacacggtgtagaaaaacct
gcatttattaacgccggtgatggaaagcacgaacatccaactcaagaattactagatgaa
tacacttttcttgaacaaatggattttgacaattcctttattcacatcgctctagttgga
gatttacttcacggaagaactgttcactcaaaagttaatggtctgaaaatttttaaaaat
gttttagttgacttgattgcacctgaagaaatatcaatgcctccccattacattaaaaag
atgaaagaaaatggctttgaagttagaattttcgattccattgaatcatatcttaaatct
actgataaggtagcaaaaatatggtactttacaaggctccagcttgaaagaatgggagaa
gatattttagaaaaagaacatgtgctacgaaaaagtgtcacatttagaaaagaatttcta
gaatatataccacaagatgttaaattttatcatcctcttccaaggcataaaatataccca
actatccccacttttttagataacttacctctcaatggttgggaacaacaggcaataaat
ggatattggactagaacagttctactatcaatgcttggtggggcattaaaagcaaatttt
gatacgtcttttaacccccaagaaaatgatgaagattttataattcctgcaccaattgta
aatggtaccaaaggagtttcaaaagaaggaaaaagaggaataaaaccgattgaaaatgga
acagtaatagaccacattgcgaaaggaaaagataaagataaaatttttgaaactatagta
aaaataagaaaaatattaaaattattcgatcttgatagtgctgatggaatattcaagtca
gaaaatggagaatttaaaggttacataagtcttccaaacagatacctttcgaaaaaagaa
ataaaaatgttgtccgcaatctctccaaatactactgtaaatataatcaaaaactctaga
gttgttgaaaaatacagaatattcttaccacctttcatctacggattctcagaattaaga
tgtaaaaatgaaaattgtattacaaatcctgtaaatggagaaaatgctgaagcatttttt
ataagaaacaacgagggagagcttgtatgtaaatactgtgaaacgcctcattcgttcgaa
gaaatttggaatatctaa

DBGET integrated database retrieval system