KEGG   Thermosipho africanus: THA_1605Help
Entry
THA_1605          CDS       T00797                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_1605 (tpiA)
   01230 Biosynthesis of amino acids
    THA_1605 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_1605 (tpiA)
   00051 Fructose and mannose metabolism
    THA_1605 (tpiA)
   00562 Inositol phosphate metabolism
    THA_1605 (tpiA)
Enzymes [BR:taf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THA_1605 (tpiA)
Exosome [BR:taf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   THA_1605 (tpiA)
  Exosomal proteins of bladder cancer cells
   THA_1605 (tpiA)
  Exosomal proteins of melanoma cells
   THA_1605 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609886..1610608)
Genome map
AA seq 240 aa AA seqDB search
MHKTPTESAHFASILLNAFHGEKEFDIIVAPTFISIPAVYEILRDSNIKVAAQNMYFEDE
GAYTGEISWKMLKESGVEYVIIGHSERRNIFGETDEMINKKIKKAIEVGLTPIFCVGEKL
EEREEGLTFAVVETQIRKGLKNIEDIENVIIAYEPVWAIGTGKVATPAQAQEVHSFIRSL
ISKMYSKERAEKVRILYGGSIKPNNFFSLIVQPDIDGGLVGGASLKESFIELGKILKQVI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactccaactgaatctgcacattttgcatcaatattactaaatgcatttcat
ggagaaaaagaatttgatattatagtcgctcctactttcatatcaataccagcagtatac
gaaattctaagagattctaatattaaggttgcagcacaaaatatgtactttgaggatgaa
ggtgcatacaccggagaaatatcttggaaaatgttaaaagaatctggtgttgagtatgta
ataattggtcatagtgaaagacgaaacatatttggagaaacagatgaaatgataaacaaa
aagataaaaaaagcaatagaagttggtttaactcctattttctgtgttggagaaaaactc
gaagaaagagaggaaggccttacatttgcagtagttgaaactcaaattagaaaaggatta
aaaaatatagaggacattgaaaatgtaattatagcttacgaaccagtctgggctattgga
acaggaaaagttgcaactccagctcaagctcaggaagttcatagctttataaggtcactt
atttcaaaaatgtactcaaaagaaagagccgaaaaagttagaatactttacggtggtagc
attaaaccaaacaacttctttagtttaatagtacaaccagacatagatggtggactagtt
ggaggagcaagtcttaaagaaagtttcatagaacttggaaaaattttaaaacaagtgata
taa

DBGET integrated database retrieval system