KEGG   Thermosipho africanus: THA_1665Help
Entry
THA_1665          CDS       T00797                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
taf  Thermosipho africanus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THA_1665 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THA_1665 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THA_1665 (thrC)
Enzymes [BR:taf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THA_1665 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673206..1674417)
Genome map
AA seq 403 aa AA seqDB search
MYKLKCITCGSIYDPEPNMYTCPKCGERYGTLEVIFNYDLINVKKSDFDKHGDISQFSKI
LPIAEYKVKQVVGNTPTYEFKNYYGIKKVFFKYDGTNPTGSYKDRASAIAISKAYEYGYD
TIYCASTGNAASSLAGLSAPTDLKTYIFVPKNIPIAKLAQLHVFGANIILIDGNYDQAFD
ISTKVGKKLNWYSRNSAINPYLLEGKKTGAMELVVQLDFNVPDIVFVSAGDGTVISSIYK
GFYDFYNLNLIQKIPKIIGIQAEGADAIAKTFSYGKPYTPVDIIPNTIADSISVGKPRDV
IKACKYVEKSGGTFLTVNDEEIKTAIFELAKNTGIFAEPAGAAAYAGFKKAISMNLLKKE
DTVAIFITGNGLKDIKAVQDNIKINPIPPVFEKIIEYINEVRK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaattaaagtgtataacctgtggtagtatttatgatccagaaccaaatatgtat
acctgccccaaatgtggtgaaagatatggaacattagaagtaatatttaattacgattta
ataaatgttaaaaaatctgattttgacaaacatggagatatttcacaattttcaaagatt
ttaccaattgcagaatataaagtcaaacaagtcgtaggtaataccccaacatatgaattt
aaaaattattatggcataaaaaaagtcttctttaaatacgatggaacaaatcccactggc
tcttacaaagatagagcctctgcaattgcaatttcaaaagcatatgaatacggatatgat
actatctactgtgcctcaactggcaatgcagcaagctctctagcaggactttcagctcct
actgatcttaaaacttatatatttgttcctaaaaatattccaattgcaaaacttgcacag
ttacatgtttttggagcaaatataattcttattgacggaaattacgaccaagcatttgat
atatctacaaaagttggcaaaaagttgaattggtattcaagaaattctgctattaatcca
taccttcttgaaggcaaaaagacgggtgccatggaacttgttgtacaacttgactttaat
gttccagatattgtcttcgtaagtgcaggagatggaacagttataagctcaatttacaaa
ggtttttatgacttttacaacttaaatcttatacaaaaaattccaaaaataataggcatt
caagcagaaggagcagatgcaattgcaaaaacattttcttatggaaaaccttacactcct
gtagatataataccaaacacaattgcagatagtatttctgttggaaagcctcgtgatgta
ataaaagcttgtaaatatgttgaaaagagtggtggaacatttttaactgttaatgatgaa
gaaatcaaaaccgcaatatttgaactagctaaaaacactggtattttcgcagaacctgca
ggtgctgctgcatatgcaggctttaaaaaagctatttctatgaatttgctaaaaaaagaa
gatactgtagcaatatttattactggaaatggcttaaaagacattaaagcagttcaagat
aacataaaaattaatcctattccaccagtttttgagaaaatcattgaatacataaatgag
gtgagaaaatga

DBGET integrated database retrieval system