KEGG   Thermosipho africanus: THA_1802Help
Entry
THA_1802          CDS       T00797                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taf  Thermosipho africanus
Pathway
taf00010  Glycolysis / Gluconeogenesis
taf00030  Pentose phosphate pathway
taf00051  Fructose and mannose metabolism
taf00052  Galactose metabolism
taf00680  Methane metabolism
taf01100  Metabolic pathways
taf01110  Biosynthesis of secondary metabolites
taf01120  Microbial metabolism in diverse environments
taf01130  Biosynthesis of antibiotics
taf01200  Carbon metabolism
taf01230  Biosynthesis of amino acids
taf03018  RNA degradation
Module
taf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_1802 (pfkA)
   00030 Pentose phosphate pathway
    THA_1802 (pfkA)
   00051 Fructose and mannose metabolism
    THA_1802 (pfkA)
   00052 Galactose metabolism
    THA_1802 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    THA_1802 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    THA_1802 (pfkA)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_1802 (pfkA)
Protein phosphatases and associated proteins [BR:taf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THA_1802 (pfkA)
Messenger RNA biogenesis [BR:taf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     THA_1802 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACJ76233
UniProt: B7IE06
Position
1794036..1794995
Genome map
AA seq 319 aa AA seqDB search
MKKIAVMTSGGDAPGMNAAIRAVVRYAVRNDIQVLGIQRGYAGLLDEDFIEMDFSSVGGI
MEKGGTILRSSRCPEFVRKETRQEAAKILAKHGVEGLIVIGGEGSLHGAMFLEEEQKVPV
VGIPGTIDNDIAMTDMSIGVDTCLNTVVDAIQKLKDTASSHERAFIVEVMGRSSGYIATV
AGLVTGAEAIVIPEIPVNYEALGNKILKERERGKINCIVVVAEGAASAYTVARHLEHRIG
YETRITILGHIQRGGSPTAFDRLLASRMGVAAVEFLKRGNSYVMTALQGGKIVPVKLDEV
LKQKKSLNMELVELTALLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctgttatgactagtggtggagatgcccctggaatgaatgccgccatt
cgtgctgtagttcgttatgctgtaaggaatgacattcaagttcttggaattcaaagaggt
tatgctggacttttggatgaagattttatagaaatggatttttcatccgttggtggaata
atggaaaaaggtggaacaattcttagaagtagtagatgtccagaatttgtgagaaaagag
acaaggcaagaagccgcaaaaatacttgcaaaacatggtgtggaaggattaattgtgatt
ggcggtgaggggagtttacatggcgcaatgtttcttgaagaagaacaaaaggtgcctgta
gtaggtattccaggcacaattgataatgatattgcaatgactgacatgagtattggcgtt
gatacttgtttaaatacagttgttgatgcaattcaaaagttaaaagacactgcttcttct
cacgagagagcatttattgttgaagttatgggaaggtcgtccggatatattgcaacagtt
gctggtcttgtaactggtgctgaggcaatagtaattccagaaatccccgtaaattatgaa
gcattaggaaataaaattttgaaagaaagggaaaggggtaaaattaattgtatcgttgtt
gtagctgaaggtgctgcaagtgcttatacagttgcaaggcatttagaacataggattgga
tatgaaacaagaataacaattttggggcatattcaaagaggaggttcacctacagctttt
gataggttactcgcatcaagaatgggagttgccgctgtggaatttttaaaacgtggaaac
agctacgttatgactgcgctacaaggtggtaaaattgtgcctgttaaactggatgaagtt
cttaaacagaaaaaatctctaaatatggaattggttgagttaactgcattactatcatga

DBGET integrated database retrieval system