KEGG   Thermosipho africanus: THA_1802Help
Entry
THA_1802          CDS       T00797                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_1802 (pfkA)
   01230 Biosynthesis of amino acids
    THA_1802 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_1802 (pfkA)
   00030 Pentose phosphate pathway
    THA_1802 (pfkA)
   00051 Fructose and mannose metabolism
    THA_1802 (pfkA)
   00052 Galactose metabolism
    THA_1802 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    THA_1802 (pfkA)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_1802 (pfkA)
Protein phosphatases and associated proteins [BR:taf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THA_1802 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1794036..1794995
Genome map
AA seq 319 aa AA seqDB search
MKKIAVMTSGGDAPGMNAAIRAVVRYAVRNDIQVLGIQRGYAGLLDEDFIEMDFSSVGGI
MEKGGTILRSSRCPEFVRKETRQEAAKILAKHGVEGLIVIGGEGSLHGAMFLEEEQKVPV
VGIPGTIDNDIAMTDMSIGVDTCLNTVVDAIQKLKDTASSHERAFIVEVMGRSSGYIATV
AGLVTGAEAIVIPEIPVNYEALGNKILKERERGKINCIVVVAEGAASAYTVARHLEHRIG
YETRITILGHIQRGGSPTAFDRLLASRMGVAAVEFLKRGNSYVMTALQGGKIVPVKLDEV
LKQKKSLNMELVELTALLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctgttatgactagtggtggagatgcccctggaatgaatgccgccatt
cgtgctgtagttcgttatgctgtaaggaatgacattcaagttcttggaattcaaagaggt
tatgctggacttttggatgaagattttatagaaatggatttttcatccgttggtggaata
atggaaaaaggtggaacaattcttagaagtagtagatgtccagaatttgtgagaaaagag
acaaggcaagaagccgcaaaaatacttgcaaaacatggtgtggaaggattaattgtgatt
ggcggtgaggggagtttacatggcgcaatgtttcttgaagaagaacaaaaggtgcctgta
gtaggtattccaggcacaattgataatgatattgcaatgactgacatgagtattggcgtt
gatacttgtttaaatacagttgttgatgcaattcaaaagttaaaagacactgcttcttct
cacgagagagcatttattgttgaagttatgggaaggtcgtccggatatattgcaacagtt
gctggtcttgtaactggtgctgaggcaatagtaattccagaaatccccgtaaattatgaa
gcattaggaaataaaattttgaaagaaagggaaaggggtaaaattaattgtatcgttgtt
gtagctgaaggtgctgcaagtgcttatacagttgcaaggcatttagaacataggattgga
tatgaaacaagaataacaattttggggcatattcaaagaggaggttcacctacagctttt
gataggttactcgcatcaagaatgggagttgccgctgtggaatttttaaaacgtggaaac
agctacgttatgactgcgctacaaggtggtaaaattgtgcctgttaaactggatgaagtt
cttaaacagaaaaaatctctaaatatggaattggttgagttaactgcattactatcatga

DBGET integrated database retrieval system