KEGG   Thermosipho africanus: THA_1929Help
Entry
THA_1929          CDS       T00797                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
taf  Thermosipho africanus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THA_1929
  Amino acid metabolism
   00300 Lysine biosynthesis
    THA_1929
Enzymes [BR:taf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     THA_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930703..1932097
Genome map
AA seq 464 aa AA seqDB search
MEQIVEDAIDKLVDKYFDEVLENLEKIIEIKSVMGPASQDAPFGVGPAKALSEALKISKK
LGFETKNIDFYAGHVTYGNSGKLYGILGHLDVVPEGDLEKWETDPYKLVIRDGKMFGRGV
SDDKGPTIGALYALKIASELVKTPKNTVRLIFGTNEENGSKCLKYYFKNEPYPDAAVTPD
GTFPLVFAEKGNTTYKISTYLNNDYNTKLIKMKAGTAVNVVPEECNVVIETDKVNEVAYL
VENFNTKCKLKYEVNGNRISITTIGKSAHASTPQLGLNSIACMLNLLSNIDFGKDNFVIR
VLNEKLGLDINGIRLGIYSKDIASGELTCNLGTINIENGDLEVKINIRYPIFMNIEMITN
QIKEAFKEFDLLQISHSKPLYVSKDSELVKMLLKVYRDVTKDEKEPIALGGGTYAKSVPY
GVAFGAVFPGEDTGMHQPNEHWSLESYKKFIRIYARLIYKWLTE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattgttgaagatgcaattgataaacttgttgataagtattttgatgaagta
ttagaaaatcttgaaaaaataattgaaattaaatcggtgatgggaccggcaagtcaagat
gcaccatttggagtagggcctgctaaggcattgagtgaagcattaaaaatttcaaaaaag
ttaggttttgaaactaaaaatattgacttttatgctgggcatgtcacttatggtaattca
ggaaaactttatggaatattaggacacttagatgtagttcctgagggagatttagaaaaa
tgggaaacagatccttataaacttgtaattagagatggaaaaatgtttggaagaggagtt
tcagatgataaaggaccaactattggagcattgtatgctttaaaaatagcatctgagttg
gtaaaaactccaaaaaacactgttaggttaatttttggaacaaatgaggaaaatggttca
aaatgtttaaaatattattttaaaaatgaaccatatccagatgcagctgtaacacctgat
gggacatttccgcttgtttttgcggaaaaaggaaatacaacttataaaataagtacttat
cttaataatgattataatactaaactgataaagatgaaagcggggactgcagttaatgtt
gttccggaagaatgtaacgtagttatagaaactgataaggtaaatgaagtagcttatctt
gttgaaaattttaatacaaagtgtaaattaaaatatgaagttaatggaaatagaatatca
ataacaactattggaaaatctgcacatgcttcaactccacaacttggcctaaattctatc
gcatgtatgttaaatcttttatcaaacattgattttggtaaggataattttgtaataaga
gttttgaatgaaaaacttggtttggatattaatggtatccgccttggtatttattctaaa
gatattgcaagtggagaacttacctgtaatttaggaacgataaatattgaaaatggggat
ttagaagtcaaaattaatataaggtatccaatatttatgaatatagaaatgattactaat
caaattaaagaagcttttaaagaatttgatcttcttcaaatttcacacagtaaaccatta
tatgtttctaaagacagtgaacttgtaaagatgttacttaaggtgtatagagatgttact
aaagatgaaaaagaacctatagcattgggcggaggaacttatgctaaatctgtaccttat
ggagtagcgtttggtgcagtatttccaggagaagatacaggtatgcatcaacctaatgaa
cattggtcgctagaatcttataagaaatttattagaatatatgcaagattgatttataag
tggttaactgaataa

DBGET integrated database retrieval system