KEGG   Thermosipho africanus: THA_196Help
Entry
THA_196           CDS       T00797                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_196
   01230 Biosynthesis of amino acids
    THA_196
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_196
   00030 Pentose phosphate pathway
    THA_196
   00051 Fructose and mannose metabolism
    THA_196
   00052 Galactose metabolism
    THA_196
  Energy metabolism
   00680 Methane metabolism
    THA_196
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_196
Protein phosphatases and associated proteins [BR:taf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THA_196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(192645..193652)
Genome map
AA seq 335 aa AA seqDB search
MRRVGVLCVGNDSPGINAAIRSAVVKGLDLNIEVMGIKDGFEGLLRDDLEVLLRPNVSNI
LHQGGTMLGTSLYVPEEDVGKVKEKVEQYGISSLLILGGRLGAKAAINLMKIGVPSVLVP
ATIDNDLAFTDFSIGFFTAVEHVKNALDVLHSTAESHHRVMIVETMGKPGGWIATIGGLS
GGADYIITSTEKPNFEELIEIIKRRYEGKKRFSLIVVESGVELPEEIKKECDGFEKLSSS
EIIGKYIEKKLKEKFGIEWRYTNLGYLQRGGSPAAMDRIIATQMAAHAIEMIKMGKVYHA
VGVKGFSITEIPYSETMLNYRPVDYYLKELTKLFY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgtaggtgtattgtgtgtaggaaatgattccccaggtataaatgcagcaata
cgttcagctgtagttaaaggattagatctaaatattgaagttatgggaataaaagatggg
tttgaagggttattgagagatgatttagaagttttattaaggcctaacgtatcgaacata
ttacatcaaggcggaactatgcttggaacatcactatatgttcctgaagaagatgtggga
aaagttaaggaaaaagttgaacagtatgggatttcatcattgctaattttaggtggaaga
cttggagcaaaagcagcaataaatttgatgaaaataggagttccttcagttttggtaccc
gcaacgattgacaatgatctggcatttactgatttttctataggattttttactgcggtt
gagcatgttaaaaacgctttggatgttcttcattctacagctgaatcacatcatagggtt
atgatagttgagacaatgggaaaaccgggcggctggattgctacaattggaggactttca
ggtggagctgactatataattacctctaccgaaaaaccaaactttgaagaacttattgaa
attataaagagaagatatgaaggtaaaaaaagattttcattaatagtagtggaatccgga
gttgaattacctgaagagataaaaaaagagtgcgatggatttgagaagttaagctcatca
gaaattattggaaagtatattgaaaaaaaattaaaagaaaagtttggaattgaatggaga
tatactaatcttggttatttacaaaggggtggatctccagccgcaatggatagaattatt
gcaactcagatggctgcacatgcaattgaaatgataaaaatgggaaaagtttatcatgcg
gttggtgtaaaaggattttctattactgaaattccttattcagaaacaatgttaaattat
agacctgtagattattatttaaaggagttaaccaagttattttattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system