KEGG   Thermosipho africanus: THA_196Help
Entry
THA_196           CDS       T00797                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
taf  Thermosipho africanus
Pathway
taf00010  Glycolysis / Gluconeogenesis
taf00030  Pentose phosphate pathway
taf00051  Fructose and mannose metabolism
taf00052  Galactose metabolism
taf00680  Methane metabolism
taf01100  Metabolic pathways
taf01110  Biosynthesis of secondary metabolites
taf01120  Microbial metabolism in diverse environments
taf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_196
   00030 Pentose phosphate pathway
    THA_196
   00051 Fructose and mannose metabolism
    THA_196
   00052 Galactose metabolism
    THA_196
  Energy metabolism
   00680 Methane metabolism
    THA_196
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_196
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     THA_196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACJ74701
UniProt: B7IF37
Position
complement(192645..193652)
Genome map
AA seq 335 aa AA seqDB search
MRRVGVLCVGNDSPGINAAIRSAVVKGLDLNIEVMGIKDGFEGLLRDDLEVLLRPNVSNI
LHQGGTMLGTSLYVPEEDVGKVKEKVEQYGISSLLILGGRLGAKAAINLMKIGVPSVLVP
ATIDNDLAFTDFSIGFFTAVEHVKNALDVLHSTAESHHRVMIVETMGKPGGWIATIGGLS
GGADYIITSTEKPNFEELIEIIKRRYEGKKRFSLIVVESGVELPEEIKKECDGFEKLSSS
EIIGKYIEKKLKEKFGIEWRYTNLGYLQRGGSPAAMDRIIATQMAAHAIEMIKMGKVYHA
VGVKGFSITEIPYSETMLNYRPVDYYLKELTKLFY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgtaggtgtattgtgtgtaggaaatgattccccaggtataaatgcagcaata
cgttcagctgtagttaaaggattagatctaaatattgaagttatgggaataaaagatggg
tttgaagggttattgagagatgatttagaagttttattaaggcctaacgtatcgaacata
ttacatcaaggcggaactatgcttggaacatcactatatgttcctgaagaagatgtggga
aaagttaaggaaaaagttgaacagtatgggatttcatcattgctaattttaggtggaaga
cttggagcaaaagcagcaataaatttgatgaaaataggagttccttcagttttggtaccc
gcaacgattgacaatgatctggcatttactgatttttctataggattttttactgcggtt
gagcatgttaaaaacgctttggatgttcttcattctacagctgaatcacatcatagggtt
atgatagttgagacaatgggaaaaccgggcggctggattgctacaattggaggactttca
ggtggagctgactatataattacctctaccgaaaaaccaaactttgaagaacttattgaa
attataaagagaagatatgaaggtaaaaaaagattttcattaatagtagtggaatccgga
gttgaattacctgaagagataaaaaaagagtgcgatggatttgagaagttaagctcatca
gaaattattggaaagtatattgaaaaaaaattaaaagaaaagtttggaattgaatggaga
tatactaatcttggttatttacaaaggggtggatctccagccgcaatggatagaattatt
gcaactcagatggctgcacatgcaattgaaatgataaaaatgggaaaagtttatcatgcg
gttggtgtaaaaggattttctattactgaaattccttattcagaaacaatgttaaattat
agacctgtagattattatttaaaggagttaaccaagttattttattaa

DBGET integrated database retrieval system