KEGG   Thermosipho africanus: THA_1970Help
Entry
THA_1970          CDS       T00797                                 

Definition
alpha-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
taf  Thermosipho africanus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THA_1970
  Lipid metabolism
   00561 Glycerolipid metabolism
    THA_1970
   00600 Sphingolipid metabolism
    THA_1970
Enzymes [BR:taf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     THA_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1982781..1984205
Genome map
AA seq 474 aa AA seqDB search
MFKVAIVGAGSAVFSLRIISDFTKILEFKDVEICLMDIDESRLNSTYILANKLNEEMGAK
LKFKTTTNLEEAIDGARFVINTAMAGGHDYLEKVRKIGEKWGYYRGIDSQEFNMVSDYYT
ISNFNQLDLFLKVARLVEEKGEKDAWLLQAANPVFEGTTLILRNVPINMVGFCHGHYGVH
RLAEVIGLDISKLDWQVAGVNHGIWLNRFLYDGKDGYKVIDEWIGNNVYEPKHPFDDQLS
LAAIDMYKFYGQMPIGDTVRNSSWKYNYDLETKKKWYGKFGGADSQIGWKWYQNNIKEIT
ETINKLANFVSMNPNIKLLDYNTYKDYMNNEIFKEEIESIINPKKFSGEQHVPFIDSIVN
NKKQRFVVNILNNGAIEGIDNDVAVEIPAWVDSSGIHPEQIMPKLSERVIKYYLKPRIMR
MEMALEAFTKGDINVLKELLFRDPRTRSEEQVEGVLNEIMNLPENAKMREYYKR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggttgcaatagttggcgcggggagcgccgttttttctttaagaattattagc
gattttacaaaaatacttgaatttaaagatgttgaaatttgtttgatggatatagatgaa
tcaaggttaaattcaacatacatccttgcaaataaattaaatgaagaaatgggagcaaaa
ttaaaatttaaaactactacaaaccttgaggaagcaattgatggagcaaggtttgtaatt
aatacagctatggcaggtgggcatgattatttagaaaaagttaggaaaataggagaaaaa
tggggctactatagaggaatagattcacaagaatttaacatggtatcagattattacaca
atatcgaattttaatcaattggatttatttttaaaagttgcaagattagttgaagaaaag
ggtgaaaaagacgcatggctattgcaggctgcaaatccagtgtttgaaggaaccacattg
attttaagaaatgtaccaataaatatggttggtttttgtcatggacactacggtgtacat
cgcttagctgaagttatagggcttgatataagcaaattagattggcaagttgcaggtgta
aatcatggtatatggttaaatagatttttgtatgatggtaaagatggatataaggtaata
gatgaatggataggaaataatgtttatgaaccaaaacatccttttgatgaccagctttct
ttagctgctatagatatgtataaattttatggacaaatgcctataggagacactgttagg
aattcttcctggaaatataattatgaccttgaaacaaagaaaaaatggtatggaaaattt
ggtggtgccgattcacaaattggttggaaatggtatcagaacaacataaaagaaattact
gaaacgattaataaattagcaaattttgtttcaatgaatccaaatatcaaattgttggat
tataatacttacaaagattatatgaataatgaaattttcaaagaagaaattgaaagcata
attaatccaaaaaaatttagtggagaacaacacgttccatttatagattcaatagttaac
aataaaaaacaaagatttgttgttaacatactaaacaacggagcaatagaaggaatagac
aacgatgtagctgttgaaattccagcgtgggtagattcatcgggaatacatcctgaacaa
attatgccaaaattatcagaaagagttattaagtattacttaaagccgagaataatgcga
atggaaatggcacttgaagcatttactaaaggagatataaatgttttaaaagaacttctt
tttagagatccaagaaccaggtctgaagagcaggtagaaggagttttaaatgaaataatg
aatttgccagaaaatgcaaaaatgagagagtattataagaggtga

DBGET integrated database retrieval system