KEGG   Thermosipho africanus: THA_290Help
Entry
THA_290           CDS       T00797                                 

Definition
pyrazinamidase/nicotinamidase-related protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
taf  Thermosipho africanus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    THA_290
Enzymes [BR:taf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     THA_290
    3.5.1.-  
     THA_290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289966..290310
Genome map
AA seq 114 aa AA seqDB search
MKALMIIDMQNDFAKKGGALYFEGAEKVIPKIIDLIKEAKNKNLPIILTQDWHDEADKEF
EIWPKHCIKNTAGAMIVSEIQELLNDYNNVYYIKKTRYSAFYKTDLENILEIFR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttaatgataattgatatgcaaaatgactttgcaaaaaaaggtggcgcactt
tactttgaaggagcagaaaaagttataccaaaaattattgatttaataaaagaggcaaaa
aacaaaaatttaccaataatattaacgcaagattggcacgatgaagctgacaaagaattt
gaaatttggccaaaacattgtataaaaaacacagctggtgctatgattgtaagcgaaata
caagaattattaaatgactacaacaacgtttactatatcaaaaaaacaagatattctgct
ttttataagacagatcttgaaaatatattagaaatctttcgatag

DBGET integrated database retrieval system