KEGG   Thermosipho africanus: THA_290Help
Entry
THA_290           CDS       T00797                                 

Definition
pyrazinamidase/nicotinamidase-related protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
taf  Thermosipho africanus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:taf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289966..290310
Genome map
AA seq 114 aa AA seqDB search
MKALMIIDMQNDFAKKGGALYFEGAEKVIPKIIDLIKEAKNKNLPIILTQDWHDEADKEF
EIWPKHCIKNTAGAMIVSEIQELLNDYNNVYYIKKTRYSAFYKTDLENILEIFR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttaatgataattgatatgcaaaatgactttgcaaaaaaaggtggcgcactt
tactttgaaggagcagaaaaagttataccaaaaattattgatttaataaaagaggcaaaa
aacaaaaatttaccaataatattaacgcaagattggcacgatgaagctgacaaagaattt
gaaatttggccaaaacattgtataaaaaacacagctggtgctatgattgtaagcgaaata
caagaattattaaatgactacaacaacgtttactatatcaaaaaaacaagatattctgct
ttttataagacagatcttgaaaatatattagaaatctttcgatag

DBGET integrated database retrieval system