KEGG   Thermosipho africanus: THA_329Help
Entry
THA_329           CDS       T00797                                 

Definition
(GenBank) endoglucanase M
Organism
taf  Thermosipho africanus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
335239..336246
Genome map
AA seq 335 aa AA seqDB search
MYLKELSEINGVSGNEKKVRDFIIEKIKDKVDKFWVDRMGNLIAFKKGNGKAKVVLDAHM
DEVGFMITNIEEDGSLSFMPVGGVDPRVVIGKKVIINDEIIGVIGFKAIHLQDDPYKAPE
FSQLKIDAGFSSKAEAEKKVKIGDYVAFTTKYKEIGNFATGKAFDDRGGCSILIDLIESN
VKSDYDLYFVFSVQEETGLRGAAVVSEQIKPDFAIALETTTAGDNPELDKSQWATHIGDG
PALTFLHSGYVIDKDLFDALVDTAKKNNIPFQYKRRTAGGTNAARYARSTYGVPAAVISI
PSRYIHSPIIVISLDDYKNSVLLVKKFLESAPVVK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaaaagagctttccgaaataaatggagtctcaggaaatgaaaagaaagtaaga
gactttatcatagaaaagataaaagataaagttgataaattttgggtagatagaatggga
aatttaattgccttcaagaaaggaaatggtaaggcaaaagttgttttggatgcacacatg
gacgaagtcggcttcatgattacaaatattgaagaagatggatcactttctttcatgcca
gttggaggtgtagatccaagggtagtaattggcaaaaaagtcattattaacgatgaaata
ataggggttattggctttaaagcaattcacttacaagatgatccatacaaagctcctgaa
ttttcacaattaaaaatcgatgcaggattttcttcaaaggcggaagcagaaaaaaaggtt
aaaataggtgattacgttgcatttacaacaaaatataaagaaattggcaactttgcaact
ggtaaagcatttgacgatagaggtggatgtagcattttaatagatttaattgaaagtaat
gtaaaaagtgactatgacctctattttgtatttagtgtgcaagaagaaacgggtcttcgt
ggtgcagcagttgttagtgaacaaataaaaccagattttgcaattgcacttgaaacaaca
acagctggtgataatcctgaattagataaatctcaatgggcaactcatattggtgatggt
ccagctttgacattcttacattcaggctatgtcatcgataaagacttattcgatgcactt
gttgatactgcaaagaaaaataacattccgttccagtataaaagaagaaccgctggcgga
acaaatgctgcaaggtatgcaagaagtacatacggtgttcctgctgcagtaatttcaatt
ccttcaagatacattcacagccctataatagtaataagccttgatgattataaaaacagt
gttttactagttaaaaaattccttgaaagtgctccagtagtaaaataa

DBGET integrated database retrieval system