KEGG   Thermosipho africanus: THA_331Help
Entry
THA_331           CDS       T00797                                 

Definition
(GenBank) gmk guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
taf  Thermosipho africanus
Pathway
taf00230  Purine metabolism
taf01100  Metabolic pathways
Module
taf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THA_331
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     THA_331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA MMR_HSR1 AAA_33 RsgA_GTPase AAA_16 Thymidylate_kin AAA_22 AAA_29 ABC_tran RNA_helicase AAA_26 NTPase_1 AAA_23 CbiA Rad10 AAA_19 AAA_28
Motif
Other DBs
NCBI-ProteinID: ACJ74831
UniProt: B7IFG7
Position
complement(336514..337146)
Genome map
AA seq 210 aa AA seqDB search
MKGTLFVVSGPSGVGKTSIISALMNKLENIVFSVSCTTRPPRPGEVDGVDYFFVSRDKFI
EMREKGEFLEWAEVHGNLYGTPKKFVLENIEKGNRIILDIDVQGALQVKRNFDDAVFIFV
APPSYEVLKERLLKRGTENSQSMLKRLENAKWEMSKIVEFDYLIVNSDLEKSILAMKSIV
IAESYRTRRILDEELIKRLFKGVSESETGN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggactttatttgtagttagtggaccatcaggagttggaaaaacaagtattatt
agtgcccttatgaataaactagagaatatagttttttctgtttcatgtactacacgccca
ccacgtccaggagaagttgatggtgtagattatttttttgtgagtagagataagtttatt
gaaatgagagaaaaaggcgaatttttagaatgggcggaagtgcatggaaatttgtatgga
acgccaaaaaaatttgtacttgaaaatattgaaaaaggtaatagaataatattggatata
gatgtacaaggagcattgcaggtaaagagaaattttgatgatgcagtatttatctttgtt
gcaccaccaagttatgaagttttgaaggagaggcttttaaaaagaggaactgaaaatagc
cagtcgatgttaaaaaggcttgaaaatgcaaagtgggaaatgtcaaagattgttgaattt
gattatttaatagtaaatagtgatcttgaaaagtctatacttgcaatgaaatctatagtt
attgcagaatcgtacagaacaaggagaattttagacgaagaattgataaaacggcttttt
aaaggggtgagtgaaagtgagaccggtaattaa

DBGET integrated database retrieval system