KEGG   Thermosipho africanus: THA_442Help
Entry
THA_442           CDS       T00797                                 

Definition
(GenBank) endoglucanase M
Organism
taf  Thermosipho africanus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
443434..444438
Genome map
AA seq 334 aa AA seqDB search
MKELIKKLTETHSPSGREHQIREVILSELEGFIDGYEVDKLGNLIVWKKGSSDKKVLFDA
HMDEIGVVVTNIDDNGFLRIDMVGGVSPYTILQSKLRFGDIIGIVGIEGETGSDMISNIK
NLSFDKLYVDIGAKSKEEAEKICPIGTFGTFDGYFVEQGDYYISKSMDDRIGCAVIIELF
KKLKNPKNSVYGVFAVQEEVGLVGATVAGYNIDPDVAIAIDVTAAGDTPKGYKRVSMKLG
NGACIKVKDNASISDKKIIDTLKDLAEKNKIPYQMEVLIFGGTDARGYQHTKAGIPSATV
SIATRYIHTPNEMVHKKDVEATIDLLLKYAEEGL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattaattaaaaaattaacagaaactcacagtccaagtggtagagaacatcag
ataagagaagttattctctctgaactcgaaggtttcatagacggatacgaagttgataaa
ctcggaaaccttattgtttggaaaaaaggttcttccgataaaaaggttctttttgacgca
catatggacgaaataggcgtagttgttacaaacatcgatgataacggttttttaagaatt
gacatggttggtggagtttcaccatatacaatattacaatctaaacttagatttggggat
atcattggaattgtaggaattgaaggtgaaacaggcagtgatatgatatcaaacattaaa
aatttgtcttttgataaattatacgtagatattggtgcaaaaagtaaagaggaagcagaa
aaaatttgcccaatcggaacatttggaacttttgatggatactttgttgaacaaggtgat
tactacatctcaaaatcaatggacgatagaataggttgcgctgtaatcatagaattattt
aaaaaacttaaaaatccaaaaaattcagtatatggtgtatttgctgtccaggaagaagtg
ggattagttggagcaaccgttgcaggttataatattgatccagacgttgctattgcaatt
gatgtaactgcagctggagataccccaaaaggatacaaaagagtctcaatgaaacttgga
aatggtgcatgtataaaagttaaagataacgcatcaataagtgacaagaaaataatagat
actcttaaagatttagcagaaaaaaataaaataccatatcaaatggaagtattaatattt
ggtggtacagatgcaagaggatatcaacacacaaaagccgggataccaagtgcaacagta
tcaatcgcaactagatatatacacacaccaaatgaaatggttcataaaaaagacgttgag
gcaacaatcgatttgctattaaaatacgctgaggagggcttataa

DBGET integrated database retrieval system