KEGG   Thermosipho africanus: THA_489Help
Entry
THA_489           CDS       T00797                                 

Definition
alkaline phosphatase 3
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
taf  Thermosipho africanus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THA_489
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    THA_489
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    THA_489
Enzymes [BR:taf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     THA_489
Exosome [BR:taf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THA_489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484977..486287
Genome map
AA seq 436 aa AA seqDB search
MKKLLLILLLLVSVFSFSVKNVIYMIGDGMGINHVMLASYLEGRLLEFMKTQNIALVTTH
SANSNVTDSAAAGTALFTGFKTNNGMIGILPDGTTVPTIAEIAAKHGVKIGIIATSRITH
ATPGAVYGHVNSRSNENTLAEQLVNSPITVAFGGGWRHFVATGGKRNDGKDLIKLAKEKG
FDYITTKEQLLNYNGKKVIGLFNSSHLPAYTDRVNEPTLSEMTKKALEILSKDNSPFFLM
IEGSQIDWEAHGNDPYGVWKEIIEFEEAFKVAMEFLKQNPDTLIIVTADHETGGLGLSSG
GYYFDVEMIRKFSKNTDFISKESNKDKNKLKELIKKYYQLELTDEDLELFDSLVKEQGNS
YYAFSNAIGRLVSKKAHLGWTTYDHTGAPVALYAFGQGADNFKGLIDNTEIPRIIARLAG
YPLTFPTYKLPVSGGH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttttacttatattgcttttactagtctctgtattttcattttctgtaaaa
aacgttatctacatgataggggatggtatgggaattaatcatgtaatgcttgcaagctat
cttgaaggaagacttctagagtttatgaaaacccaaaatattgcactagtaactacacat
tctgcaaatagtaatgttacggattcagcagctgctggaactgcactttttactggtttt
aaaactaacaatggaatgatcggcatattgccagatggtacaactgttcctacaattgca
gagattgcagcaaaacacggtgtaaaaattggaataatagcaacatcaagaattactcac
gcaaccccaggtgcagtgtacggtcatgtaaattcaagaagtaacgaaaacactcttgca
gaacaattagttaacagccctataacagttgcgtttggtggcggctggagacattttgta
gcaactggcggaaaaagaaatgatggtaaagatctaattaaattggcaaaagaaaaggga
tttgattatattacaacaaaagaacaattacttaattacaacgggaaaaaagtaatagga
cttttcaattcaagccatttaccagcgtatactgatagggtaaatgaaccaacactttct
gagatgacaaaaaaagcccttgaaatactgtcaaaagataattcacctttctttttaatg
atcgaaggctcacaaatagactgggaagcacatggaaatgatccatacggcgtttggaaa
gaaataattgaatttgaagaagcattcaaagttgctatggaatttttaaaacaaaaccca
gatactttgattattgtaacagcagatcacgaaactggaggtctcggtctttcaagcgga
ggatactattttgatgttgaaatgataagaaaatttagtaaaaacacagattttatatca
aaagaatcaaataaagacaagaataaattaaaagagctcattaaaaaatactatcaatta
gaattaaccgatgaagacttagagctttttgactctctagtaaaagaacagggaaactca
tattatgcattttcaaatgcaataggaagattagtaagtaaaaaggcacaccttggttgg
actacatatgatcacacaggcgcacctgttgcactatacgcatttggacaaggcgctgat
aactttaaaggtttaatagataacactgaaataccaagaattattgcaagacttgcagga
tacccacttacattccctacctataaactaccagtatcaggtgggcattaa

DBGET integrated database retrieval system