KEGG   Thermosipho africanus: THA_518Help
Entry
THA_518           CDS       T00797                                 

Definition
(GenBank) pyruvate oxidoreductase beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_518
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_518
   00020 Citrate cycle (TCA cycle)
    THA_518
   00620 Pyruvate metabolism
    THA_518
   00640 Propanoate metabolism
    THA_518
   00650 Butanoate metabolism
    THA_518
  Energy metabolism
   00680 Methane metabolism
    THA_518
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THA_518
Enzymes [BR:taf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THA_518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(524452..525429)
Genome map
AA seq 325 aa AA seqDB search
MALNIMQLATMFADKHPGITSGHRLCPGCAAPNVAKFALMTAEALGYTPVVGFATGCMEV
STTIYPYTAWNVPYIHNAFENVAATVSGVETAYRALLKKGRLVDPNKKYAFFAFGGDGGT
YDIGLQALSGAVERGHKFIYIVYDNEGYMNTGNQRSGATPPGSQTTTQPVGKKLSGKIQL
KKNIVEIMAAHENVYVATVSTSEPMDFFKKIEKALNFDGPSFIAAMSPCVRFWRVNDDKA
VEISKLAVETGYWPLYEVERGVYRVTKKVKELKPVREFIEKQGRFRPLLKRPDADEIINE
LQEYVTSRWERLLALEEATKDKPIR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaatataatgcaacttgcaacaatgtttgcagataaacaccctggtataaca
tccggtcacagactttgcccaggttgtgctgctccaaatgtagcaaaatttgcccttatg
acagcagaagcacttggttataccccagttgttggatttgcaacaggatgtatggaagtt
tcaactacaatctatccatacacagcatggaatgttccatatattcataatgcatttgaa
aatgttgcagcaacagttagtggtgtagaaactgcatatagggcccttttgaaaaaagga
agacttgttgatccaaacaaaaaatatgcattctttgcatttggtggagatggaggaaca
tacgatatcggtcttcaagcactttctggtgcagttgagagaggacacaaatttatttat
atagtatacgataatgaaggttatatgaatactggaaaccagagatcaggtgctacacct
cctggttctcaaacaacaacacaaccagtaggtaaaaaattgtctggtaagatccagctt
aaaaagaacattgtagaaattatggctgctcacgaaaatgtatacgttgcaacagtatcc
acttctgaaccaatggatttcttcaaaaaaatcgaaaaagcattaaactttgatggccca
tcatttatagctgcaatgtctccatgtgtaagattctggagagttaatgatgataaagca
gttgagatttcaaaacttgcagtagaaactggttattggccattgtatgaagtagaaaga
ggagtatatagagtaacaaagaaagtaaaagaattaaaaccagttagagaattcattgaa
aaacaaggaagatttagacctctcttgaagagaccagatgctgatgaaataatcaatgaa
ttgcaagaatatgtaacaagtagatgggaaagacttcttgcacttgaagaagcaacaaaa
gataaaccaattagataa

DBGET integrated database retrieval system