KEGG   Thermosipho africanus: THA_519Help
Entry
THA_519           CDS       T00797                                 

Definition
(GenBank) pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
taf  Thermosipho africanus
Pathway
taf00010  Glycolysis / Gluconeogenesis
taf00020  Citrate cycle (TCA cycle)
taf00620  Pyruvate metabolism
taf00640  Propanoate metabolism
taf00650  Butanoate metabolism
taf00680  Methane metabolism
taf01100  Metabolic pathways
taf01120  Microbial metabolism in diverse environments
taf01130  Biosynthesis of antibiotics
taf01200  Carbon metabolism
Module
taf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_519
   00020 Citrate cycle (TCA cycle)
    THA_519
   00620 Pyruvate metabolism
    THA_519
   00640 Propanoate metabolism
    THA_519
   00650 Butanoate metabolism
    THA_519
  Energy metabolism
   00680 Methane metabolism
    THA_519
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THA_519
Enzymes [BR:taf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THA_519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: ACJ75008
UniProt: B7IFZ4
Position
complement(525443..526621)
Genome map
AA seq 392 aa AA seqDB search
MPEVKNRQAVTGAQAIANAMRQINPDVVAAYPITPQTPVVEYFAQFVADGAVETEMIPVE
SEHSAMSAVVGAAAAGARAMTATAANGLALMHEIVYIAASSRLPIVMAVANRALSGPINI
HCDHSDAMAERDSGWIQLWAENAQEAYDFTLMAIRIAEHEDVRLPVMVNFDGFIISHGVE
VVDFLDDEVARKFVGEPKVMYPLLDTEHPVTHGPLDLYDYYFEHKRQQIEAMKHVKKVFK
EVAEEFAKISGRKYDLLDKYKVDDAEYIMIALGSTAGTIKYTVDLLREEGHKVGVIKPQI
FRPFPKNELQELLNGRKGVIVLDRAASFGAEAPLYEAVKSALYEVAVKPQIGSYVYGLGG
RDIKIEHIRKAFEDAFSGNLIADEERYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtaaaaaatagacaagcagttactggcgcgcaagcgattgcaaatgctatg
cgtcaaataaatcctgatgttgttgcagcttacccaattacccctcaaacacctgtcgtc
gaatattttgcgcaatttgttgcagatggtgctgtagaaactgaaatgatcccagttgaa
agtgaacatagtgcaatgagtgctgttgtcggtgcagcagcagcaggtgctcgtgcaatg
acagcaacagcagcaaatggtcttgcattgatgcacgaaattgtatacatagcagcatct
tcaaggcttccaattgttatggctgttgcaaatagggctctttctggaccaattaacatt
cactgtgaccacagtgatgctatggcagaaagagattctggatggattcaactttgggca
gaaaatgctcaagaagcttatgattttacattaatggcaataagaattgcagaacatgaa
gatgttagattgcctgttatggtaaattttgacggttttattatttcacatggtgttgaa
gtagtagactttttagatgatgaagtagcaaggaaatttgttggtgagccaaaagttatg
tatccacttcttgatacagagcatccagtaacacacggtccactagatctatatgattat
tattttgaacacaaaaggcaacaaattgaagcaatgaaacatgttaaaaaagtatttaaa
gaagttgcagaagaatttgcaaagatttcaggaagaaaatatgatcttcttgataagtat
aaagttgatgatgcagagtacataatgattgcacttggttcaacagcaggaacgattaaa
tatactgttgatcttttaagagaagaaggacacaaagtaggagtaataaagccacaaatc
tttagaccattcccaaagaatgaattgcaggaattactaaatggtcgaaaaggtgttatt
gtattagatagagcagcatcatttggtgcagaagcacctctatatgaggctgtaaagagt
gcactttatgaagttgctgtaaaaccacaaatcggaagttatgtctatggacttggtgga
agagatattaagattgagcacattagaaaagcatttgaagatgcatttagtggtaactta
atagctgatgaagaaagatacctaggactcagggaataa

DBGET integrated database retrieval system