KEGG   Thermosipho africanus: THA_520Help
Entry
THA_520           CDS       T00797                                 

Definition
(GenBank) pyruvate synthase subunit PorD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
taf  Thermosipho africanus
Pathway
taf00010  Glycolysis / Gluconeogenesis
taf00020  Citrate cycle (TCA cycle)
taf00620  Pyruvate metabolism
taf00640  Propanoate metabolism
taf00650  Butanoate metabolism
taf00680  Methane metabolism
taf01100  Metabolic pathways
taf01120  Microbial metabolism in diverse environments
taf01130  Biosynthesis of antibiotics
taf01200  Carbon metabolism
Module
taf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_520
   00020 Citrate cycle (TCA cycle)
    THA_520
   00620 Pyruvate metabolism
    THA_520
   00640 Propanoate metabolism
    THA_520
   00650 Butanoate metabolism
    THA_520
  Energy metabolism
   00680 Methane metabolism
    THA_520
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THA_520
Enzymes [BR:taf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THA_520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_7 Fer4_10 Fer4_4 Fer4_17 Fer4_13 Fer4_16 Fer4_2 Fer4_8 Fer4_15 ETF_QO Fer4_3 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACJ75009
UniProt: B7IFZ5
Position
complement(526635..526967)
Genome map
AA seq 110 aa AA seqDB search
MAELKGWKDIPIGGVIDKPATAKEYQTGTWRVIRPVHQPENCIHCMMCWLYCPDQAIVIE
VVDGKPKMKGYNYYYCKGCGLCANVCPKTNDNLPEEKRAIVMKPETEFQD
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcaaaggatggaaagatattccaattggcggagttatagataaacccgct
actgcaaaagaatatcaaacaggaacatggagagttattagacccgttcaccaaccagaa
aattgtattcattgtatgatgtgttggctttactgtcctgatcaagcaattgtaattgaa
gttgtagatggaaagccaaaaatgaaaggatacaattattattactgtaaaggttgcgga
ctttgtgcaaatgtatgtccaaaaacaaatgataaccttcctgaagaaaaaagagcaatt
gttatgaaacctgaaacggaattccaagactaa

DBGET integrated database retrieval system