KEGG   Thermosipho africanus: THA_53Help
Entry
THA_53            CDS       T00797                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
taf  Thermosipho africanus
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_53
   01230 Biosynthesis of amino acids
    THA_53
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THA_53
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    THA_53
Enzymes [BR:taf01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     THA_53
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54367..56229
Genome map
AA seq 620 aa AA seqDB search
MNLNLEEISKKCRGDILTMTTVAQSGHPGGSMSSIDILVSLYSFARVFPNDPWNEDRDRI
IVSHGHISPAVYSTLAAYGFINREEVLTGFRHPSSIFEGHITRGIPGVEWTTGNLGQGLS
AGVGMALAGKLKNKDYHVYVVMSDGESAKGQVAEARRTANKYNLDNLTVIIDYNDIQISG
RAREIMYVDLKKEYEAAGWNTLEINGHDFEQILSALKIAKNDGKPTAIIAHTIIGKGVSF
MEDTPKYHGKPLSIEEFKKAIQELGLNIDIDKYIENRKKLPISEHKKLLLKYDVNINKGE
FRTYTEKTDNRSALGRAIADLALINDNVVAVDCDLKSSVKLDFLDKERKDRLIEIGVQEH
NAAALAGALSVEGFITFFADFGVFGIDETFNQHRLNAINNTNLKVVVTHCGTDVGEDGKT
HHALNYVSAPLSWFGFKVIVPADPNQTDRAVRYVASEYGNFVIAMGRSKLEPIKKEDGSI
FFDENYEFKYGKIDILRDGDDIVIITMGSIIPPALKAVDELRNEGIKVGLLNVSCPLDLD
EEVLTRYTRNKVIVIEDHNVYNGLGTLIENKLFNLKIIPDKFVKIGIDRFPVSGNSNYLF
KIYGFDSDSIKNKVKEILED
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttaaatcttgaagaaatttcaaaaaaatgtagaggagatattttaaccatgacc
accgtagctcaatctggacatccaggtggttctatgtcatcaattgatattttagttagt
ttatactcttttgcaagagtttttccaaatgatccttggaacgaagatagagatagaatc
atagttagccatggtcacatttcacctgcggtatatagtacacttgcagcgtatgggttt
atcaatagagaagaagttttaactggttttagacatccatcaagtatttttgaaggacat
atcacaagaggtattcctggcgttgaatggactactggaaatcttggccaaggactttcc
gcaggtgttggaatggctttagctggaaaattaaaaaataaagactatcatgtttacgtt
gttatgagtgacggtgaaagtgcaaaaggccaagtagcagaagcaagaagaactgcaaat
aaatataatctcgataacctaactgttattattgactataacgatattcaaatcagcggg
agagcaagagagataatgtatgtagatctaaaaaaagaatatgaagcagctggatggaat
actttggaaataaacggacacgatttcgagcaaatactctcggctctaaaaattgctaaa
aatgatggaaaaccaacagcaataattgcacatactattattggaaaaggcgtaagcttt
atggaagatacaccaaaataccacggtaaaccattatcaatagaagaattcaaaaaggct
attcaagaactcggattaaatattgatatagataaatacattgaaaatagaaaaaaactg
ccaatatcagaacataaaaaattattattaaaatacgatgtaaatatcaataaaggcgaa
tttagaacttatacagaaaaaactgataatagatcagcattgggaagagctattgctgat
cttgcattaataaatgataacgttgtagcggttgattgcgatctcaaatcttctgtgaaa
ttagattttcttgacaaagaaagaaaggataggcttattgaaattggcgttcaagaacat
aatgctgctgcattagcaggtgcactaagtgttgaaggatttattacattctttgcagat
tttggagtatttgggatagatgaaacatttaatcaacataggttaaacgcaattaataat
acaaaccttaaggttgtagtaactcactgcggaacagatgttggtgaagatggaaaaaca
catcatgcgttaaattatgtttctgcacctctatcatggtttggctttaaagtcattgtt
cctgcagatccaaatcaaactgatagagcagtaagatatgttgcttcagaatatggaaat
tttgtaatagctatgggtagaagtaaattagagcctataaaaaaagaagatggaagcata
ttctttgatgaaaattacgaatttaaatatggaaaaattgatatattaagagatggagat
gatattgtaattatcacgatgggttcaataattcctccagcattaaaagcagtagatgaa
ctaaggaatgaaggaatcaaagtaggtttacttaatgtatcttgtccacttgatttagac
gaggaagttcttacaagatacacacgaaacaaagtgattgtaattgaagaccataatgtt
tacaatggacttggaacattaatagaaaacaaactcttcaatctaaaaattatccctgac
aaatttgttaagattggtattgacaggttcccagtatctggtaatagcaattacttattc
aaaatttatggttttgatagtgatagtattaaaaataaagttaaagaaatattagaagac
taa

DBGET integrated database retrieval system