KEGG   Thermosipho africanus: THA_53Help
Entry
THA_53            CDS       T00797                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
taf  Thermosipho africanus
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:taf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:taf01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:taf00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54367..56229
Genome map
AA seq 620 aa AA seqDB search
MNLNLEEISKKCRGDILTMTTVAQSGHPGGSMSSIDILVSLYSFARVFPNDPWNEDRDRI
IVSHGHISPAVYSTLAAYGFINREEVLTGFRHPSSIFEGHITRGIPGVEWTTGNLGQGLS
AGVGMALAGKLKNKDYHVYVVMSDGESAKGQVAEARRTANKYNLDNLTVIIDYNDIQISG
RAREIMYVDLKKEYEAAGWNTLEINGHDFEQILSALKIAKNDGKPTAIIAHTIIGKGVSF
MEDTPKYHGKPLSIEEFKKAIQELGLNIDIDKYIENRKKLPISEHKKLLLKYDVNINKGE
FRTYTEKTDNRSALGRAIADLALINDNVVAVDCDLKSSVKLDFLDKERKDRLIEIGVQEH
NAAALAGALSVEGFITFFADFGVFGIDETFNQHRLNAINNTNLKVVVTHCGTDVGEDGKT
HHALNYVSAPLSWFGFKVIVPADPNQTDRAVRYVASEYGNFVIAMGRSKLEPIKKEDGSI
FFDENYEFKYGKIDILRDGDDIVIITMGSIIPPALKAVDELRNEGIKVGLLNVSCPLDLD
EEVLTRYTRNKVIVIEDHNVYNGLGTLIENKLFNLKIIPDKFVKIGIDRFPVSGNSNYLF
KIYGFDSDSIKNKVKEILED
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttaaatcttgaagaaatttcaaaaaaatgtagaggagatattttaaccatgacc
accgtagctcaatctggacatccaggtggttctatgtcatcaattgatattttagttagt
ttatactcttttgcaagagtttttccaaatgatccttggaacgaagatagagatagaatc
atagttagccatggtcacatttcacctgcggtatatagtacacttgcagcgtatgggttt
atcaatagagaagaagttttaactggttttagacatccatcaagtatttttgaaggacat
atcacaagaggtattcctggcgttgaatggactactggaaatcttggccaaggactttcc
gcaggtgttggaatggctttagctggaaaattaaaaaataaagactatcatgtttacgtt
gttatgagtgacggtgaaagtgcaaaaggccaagtagcagaagcaagaagaactgcaaat
aaatataatctcgataacctaactgttattattgactataacgatattcaaatcagcggg
agagcaagagagataatgtatgtagatctaaaaaaagaatatgaagcagctggatggaat
actttggaaataaacggacacgatttcgagcaaatactctcggctctaaaaattgctaaa
aatgatggaaaaccaacagcaataattgcacatactattattggaaaaggcgtaagcttt
atggaagatacaccaaaataccacggtaaaccattatcaatagaagaattcaaaaaggct
attcaagaactcggattaaatattgatatagataaatacattgaaaatagaaaaaaactg
ccaatatcagaacataaaaaattattattaaaatacgatgtaaatatcaataaaggcgaa
tttagaacttatacagaaaaaactgataatagatcagcattgggaagagctattgctgat
cttgcattaataaatgataacgttgtagcggttgattgcgatctcaaatcttctgtgaaa
ttagattttcttgacaaagaaagaaaggataggcttattgaaattggcgttcaagaacat
aatgctgctgcattagcaggtgcactaagtgttgaaggatttattacattctttgcagat
tttggagtatttgggatagatgaaacatttaatcaacataggttaaacgcaattaataat
acaaaccttaaggttgtagtaactcactgcggaacagatgttggtgaagatggaaaaaca
catcatgcgttaaattatgtttctgcacctctatcatggtttggctttaaagtcattgtt
cctgcagatccaaatcaaactgatagagcagtaagatatgttgcttcagaatatggaaat
tttgtaatagctatgggtagaagtaaattagagcctataaaaaaagaagatggaagcata
ttctttgatgaaaattacgaatttaaatatggaaaaattgatatattaagagatggagat
gatattgtaattatcacgatgggttcaataattcctccagcattaaaagcagtagatgaa
ctaaggaatgaaggaatcaaagtaggtttacttaatgtatcttgtccacttgatttagac
gaggaagttcttacaagatacacacgaaacaaagtgattgtaattgaagaccataatgtt
tacaatggacttggaacattaatagaaaacaaactcttcaatctaaaaattatccctgac
aaatttgttaagattggtattgacaggttcccagtatctggtaatagcaattacttattc
aaaatttatggttttgatagtgatagtattaaaaataaagttaaagaaatattagaagac
taa

DBGET integrated database retrieval system