KEGG   Thermosipho africanus: THA_541Help
Entry
THA_541           CDS       T00797                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
taf  Thermosipho africanus
Pathway
taf00900  Terpenoid backbone biosynthesis
taf01100  Metabolic pathways
taf01110  Biosynthesis of secondary metabolites
taf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THA_541 (ispE)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     THA_541 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACJ75029
UniProt: B7IG15
Position
complement(550102..550929)
Genome map
AA seq 275 aa AA seqDB search
MEQNGSTVVRAYAKINLSLDVVKKRDDGYHEINSLFQNISLYDRLSIVKIDRGLEIKSNV
EIENNILYKVWDLFCEKYKEPEFGFRVILEKNIPMEAGLGGGSADAAALLFFLGKTFKIP
TSELLNLAIKIGSDVPFFLIGGTAVVKGKGEKIEPLPALKGYYVDLLTSENGISTKEAYS
LLNPSLFNRAPCSPYVLYEAYKNRNAGEIKRCTYNIFEKVVANNYKEIMANIKRLRRTHI
TAALTGSGSAVFGVSFRDGKYKFVSRGVEYEETKL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaacggtagtacagtcgttagagcttatgcaaaaataaatctttctttggat
gtagtaaaaaaaagagacgatggatatcatgaaattaattcattatttcagaatatatct
ctttatgatagattgtcaattgtaaagatagatagaggacttgaaattaaatcaaatgtt
gaaattgagaataatatactttataaagtatgggatttgttttgtgaaaaatacaaagag
ccagaatttggttttagggtaattcttgaaaaaaacattccaatggaagcaggactaggt
ggaggaagtgctgatgctgcagctttattgttttttcttggaaaaacttttaaaattcca
acttctgaacttttgaatttagcaataaaaattggtagcgatgttcctttttttctaata
ggaggtactgcagtagttaagggaaaaggagaaaaaattgaaccacttccggctcttaaa
ggctattatgtagaccttttgactagtgaaaatggtatatctacaaaggaagcgtatagt
cttttaaatccttctttgtttaacagagcaccatgttctccatatgtcttatacgaagca
tataaaaacaggaatgcaggagaaattaaaaggtgtacttataatatttttgaaaaggtg
gttgcaaataactataaagaaattatggcgaatataaaaaggttaagaaggactcatata
acagcagctttaacaggtagtggaagcgctgtttttggcgtttcgtttagagatggtaag
tataagtttgtttcaaggggggttgaatatgaagaaactaagttataa

DBGET integrated database retrieval system