KEGG   Thermosipho africanus: THA_674Help
Entry
THA_674           CDS       T00797                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
taf  Thermosipho africanus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THA_674 (rbsK)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     THA_674 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677149..678057
Genome map
AA seq 302 aa AA seqDB search
MIAVVGSSNMDVVLTVERFTLPGETQKAQKLEFFPGGKGSNQAVSIAKLSKKNSNVYFLT
CIGNDSYGRILKGQYDKLNIEGYVVVDDNNGLAFIEVTKKGENRIVIYPGANRNLTKEII
KKHEEKLLEADYILLQNEIPFESTLYSARIFSENGKIVIFDPAPVSGIEKEIFQFVDFLT
PNEEEIKLLTEKFFGEFVSYEDSYFKLKSLGVKKLIVKLGSKGVIYFEGDKRIEIPSFKV
KAVDTTAAGDVFNGAFVVALHENLDIKKSLEFASAAAALSVTKKGAQNSIPSRKEVENFL
NI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagtagttggaagttcaaatatggatgttgttttaacagttgagagatttact
ttacctggtgaaactcaaaaagctcaaaaattagagttttttcctggtggaaaaggttcg
aaccaggcagttagtatagcaaaactttctaagaaaaattctaatgtttattttttaacc
tgtattggtaatgactcttacgggagaattttaaaaggtcaatacgataaattaaatatt
gaaggatacgtggtagttgatgataataatggcttagcttttattgaagttacaaaaaaa
ggtgaaaatagaattgtaatatatcctggagcaaatagaaacttaactaaagaaattata
aaaaagcatgaagaaaaacttttagaagctgattacattttacttcaaaatgagattcca
tttgagtcaactttatattctgcccggatttttagtgaaaatggaaaaattgttattttt
gaccctgctccagtaagtggaattgaaaaggaaatttttcaatttgtagattttttgaca
ccaaatgaagaagaaataaaacttttaacagaaaagttctttggagaatttgtctcgtat
gaagatagttattttaaacttaaaagcttaggagtaaaaaaactcattgtaaaacttgga
agcaagggagtaatttattttgaaggtgataaaaggatagaaattccatcttttaaagtt
aaggctgttgatacaacggcagcgggagatgtttttaacggagcatttgttgtagctttg
catgaaaatcttgatataaaaaaatcattggaatttgcctcagcagcagctgctttgtca
gttacaaaaaaaggtgcgcaaaattctattccttcaagaaaagaagttgaaaacttttta
aatatataa

DBGET integrated database retrieval system