KEGG   Thermosipho africanus: THA_825Help
Entry
THA_825           CDS       T00797                                 

Definition
alkaline phosphatase 4
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
taf  Thermosipho africanus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:taf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:taf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:taf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(838921..840231)
Genome map
AA seq 436 aa AA seqDB search
MKKLLLCLFLLLALFSFAVTNVIYMVGDGMGINHALLASYLEGRILNFLKTQNIGIITTH
SANSNVTDSAAAGTALFTGFKTNNGMIGMLPDGTIVPTIAEIAAKQGVKIGIISTSRITH
ATPGAVFGHVESRDDENTLAEQLVNSPITVAFGGGWRHFVATGGKRKDGKDLIKLAKEKG
FDYITTKEELLNYKGNKVIGLFNSSHLPAASDRIKEPMLAEMTKKALEILSKDGKPFFLM
IEGSQIDWEAHGNDPFGVWKEIIEFEQAFNVAMEFLKENPDTLIIVTADHETGGLGLSTG
GYFFDVEMLRQFTKNTDFIAKQANNDKNKVRELIKQYYGIELTDEDMEYFDLIVKEQAGS
YYAFSNAIGRVVSRKAHLGWTTFAHTGAPVALYAFGKGAENFNGFYDNTEIPRIIGRIAG
YELTFPTYELPVSGGH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattattactttgtttatttctattgttagctttatttagttttgcagttacc
aacgtcatttatatggttggcgacggaatggggataaaccatgctttgcttgcaagttat
cttgaaggaagaattttaaatttcttgaaaacccaaaacattggtattataactactcac
tcggcaaatagcaatgttacagattcagctgccgcaggaacagctttattcactggattt
aaaacaaataatgggatgataggtatgttaccggatggaacaattgttcctacaatagcg
gaaatagctgcaaaacaaggggtaaaaatagggattatttctacttctagaatcacccat
gccactccgggtgctgtatttggtcatgtagaatcaagagatgatgaaaatacacttgct
gaacaattagttaacagccctattacagttgcatttggtggaggttggagacattttgtt
gcaacaggtggcaaaaggaaagatggaaaagatttaattaaactcgcaaaagagaaaggt
tttgactatattacaactaaagaagaattattaaattataaaggaaataaagttattggt
ttatttaattcaagtcatcttcctgctgcatcagatagaatcaaagaaccaatgttagct
gaaatgaccaaaaaagctctcgaaatcctatcaaaagatggaaagccatttttcttaatg
attgaaggttcccaaattgattgggaagctcatggaaatgatccatttggcgtatggaag
gaaattattgaatttgaacaagcatttaacgtagccatggaatttctaaaagaaaatcca
gatactttaataatcgtaactgctgatcacgaaactggtggattaggactttccacaggt
ggttatttctttgatgtcgaaatgttaagacaatttacaaaaaatacagattttatagct
aaacaagctaataatgataaaaataaagttagagaattaatcaaacaatattatggaata
gaattaacagatgaagatatggaatattttgatctcatagtaaaagaacaggctggttct
tactatgcattttcaaatgcaattggaagagttgtcagtagaaaagcacatcttggatgg
actacttttgctcacactggagcacctgttgctttgtatgcatttggaaaaggcgcagaa
aactttaacggattctatgataacactgaaattccaagaattattggaagaatagctgga
tatgaacttacattcccaacatatgaattgccagtatcgggaggacactaa

DBGET integrated database retrieval system