KEGG   Thermosipho africanus: THA_899Help
Entry
THA_899           CDS       T00797                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
taf  Thermosipho africanus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:taf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:taf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921920..923401
Genome map
AA seq 493 aa AA seqDB search
MKIKDILRELNSLILKVNCDEELEFNYISSNSKDIQENTLFICRKGTSFDSHNIVDDLYK
EGANVFVVEREIRKYPYIQVVDSRIAESIIASMFYSKPYEKLITFGVTGTNGKTTSVHLF
HHIMHNFGIKGSISGTVVNDIMGDKFYHPNTTPSAIEIMRNMHKTLENGGKYYGMEVSSH
ALSQYRVESIRYDIVGITNITRDHLDFHETFENYKKAKFHILNLLKPNGIAVVNHELLQE
VKNKNKNIKLVSFGVDSSSDYVIHEITTNWSGTFFKLDTPYGEKKVASQLIGEYNAFNIT
LVVAALAEIGYDIDEVIASVATFRGVDGRFEIIPEAKKLGIEIVVDFAHTPDALEKVILS
LRKLTKGRLITVFGAGGQSDIGKRPMMGEVVSKYSDISIITTDDPRGEDPLKIIKDVEAG
LVPGSLSLSIEDRKEAIDTAITLANRGDVILIAGRGHEPYQVFDENHKVPFKDRDVAIDI
IFQKINKGEKTFK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcaaggatattttaagagaattaaattctttaattcttaaggtaaactgcgat
gaagagctcgaatttaattatatctcttcaaattcaaaagatattcaagaaaacaccctt
tttatttgcagaaaagggactagttttgattcgcacaatattgtagatgacctctacaaa
gaaggtgcaaacgtttttgttgtagaaagagaaataagaaaatatccttacatacaagtt
gttgattcaagaattgcagaatcaataattgcaagtatgttttacagcaaaccatacgaa
aaacttatcacatttggtgttacgggaaccaacggaaaaacaacttcagtgcatttgttc
catcacatcatgcacaactttggaataaaaggaagtataagtggcacagtggtaaatgat
ataatgggtgataaattttatcatccaaacacaacgccaagtgccattgaaataatgaga
aatatgcacaaaacccttgaaaatggtggaaaatactatggaatggaagtttcatcccat
gctctttcacagtatagagtggaaagcatacgctacgatattgtaggtataacaaacata
acaagagatcaccttgattttcatgaaacttttgaaaactacaaaaaggcaaaatttcat
atcttaaaccttttaaaaccaaatggaattgcagtggtaaatcatgaacttttgcaagag
gtcaaaaacaaaaacaaaaatataaaacttgttagctttggagtagacagttcatcagat
tacgttatacatgaaattacaaccaattggtctggtacattcttcaagttagacactcca
tacggtgaaaagaaagttgcatcacaattaattggagagtacaatgcatttaatattaca
ttggtagtggctgctcttgccgaaataggctacgatatagatgaggtaattgcatctgtt
gcaacattccgtggagttgacggtagatttgaaatcatacctgaggcaaagaaacttgga
atagaaatagttgttgattttgcccatactcccgatgcacttgaaaaggtaatactctcg
cttagaaaacttaccaaaggaagacttattaccgtctttggagcgggggggcaatctgat
atagggaaaaggccaatgatgggagaagtagtatcaaaatactcagatataagcattatt
acaactgatgatccaaggggtgaagatcctttaaagataattaaagatgttgaggctggt
cttgttccaggaagtttaagcctttccattgaagacagaaaagaagctattgatactgct
atcacacttgcaaacagaggagatgtaatattaattgcaggaagagggcatgaaccatat
caagtatttgatgaaaatcacaaagtgccatttaaagatagggatgttgcaatagatatt
atctttcaaaaaataaataaaggggaaaagacgttcaaatga

DBGET integrated database retrieval system