KEGG   Thermosipho africanus: THA_927Help
Entry
THA_927           CDS       T00797                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
taf  Thermosipho africanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:taf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THA_927
   01230 Biosynthesis of amino acids
    THA_927
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THA_927
   00030 Pentose phosphate pathway
    THA_927
   00051 Fructose and mannose metabolism
    THA_927
   00052 Galactose metabolism
    THA_927
  Energy metabolism
   00680 Methane metabolism
    THA_927
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    THA_927
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THA_927
Protein phosphatases and associated proteins [BR:taf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THA_927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(950225..951412)
Genome map
AA seq 395 aa AA seqDB search
MKVLYAQSGGVTSVINASAYGVLDEAKKAGLEVYVGIHGISGVLRENLLRINDIDIEGLK
YTPSAAFGSCRRKLKNQEDINKLFEIFEKYEIEYFFYNGGNDSMDTAWRLHNEAQKRNFP
LKVIGVPKTIDNDLPYTDHCPGYGSAAKYIATAMMEATLDLRSMYADSTRVFVMEIMGRH
AGWLAAAAGLGWLNGIGPDIILFPEVVFNKERFLDKVDEKIRRKGYCSIAVSEGIKYEDG
FFVADMGYTDSFGNRQLGGVGFTIAGMVRSELSLKTHVAIPDYLQRSGRHIASKTDVEEA
EGVGREAVRLALSGVSGVMVTIERISNDPYKVEFKTVELNKVAEQTKYLPEDFHNEFEVT
DKFIKYAKPLIEGEFFPPFKNGLPDYLIIEEVEQQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttatacgcacaatcaggtggagtaacaagtgttatcaatgcatcggcatat
ggagttttggatgaagctaaaaaagcagggcttgaggtatatgtaggcattcatggaatt
tctggtgttttaagagaaaatcttttaagaataaatgacattgatatagaaggtcttaaa
tatacgccttcagcagcttttggttcttgtagaaggaaactaaaaaatcaagaggatatc
aataaattatttgaaattttcgaaaagtatgaaatagagtatttcttttacaatggtgga
aatgattctatggatacagcatggaggttgcataacgaagctcaaaaaagaaattttcca
cttaaggttataggtgttccaaaaactattgacaatgatttgccttatactgaccattgt
ccaggatatggttcagctgcaaagtatatagcaactgcaatgatggaggctactcttgat
ctaagaagcatgtatgctgattcaacacgtgtttttgtaatggaaataatgggaaggcat
gctggttggcttgcggctgctgctgggcttggttggttaaacggtataggaccagatatt
atccttttcccggaggttgtttttaacaaagaaaggtttcttgataaggtagatgaaaaa
ataagaagaaaagggtattgttcaatagcggtttctgagggtataaagtacgaagatgga
ttttttgttgctgatatgggatatacggatagttttggaaatagacaacttggcggcgta
ggttttacaatagcaggtatggtaagatcagaactttctttgaagactcatgttgcaatt
cctgattatcttcaaagaagtggaagacacatagcaagtaaaacagatgttgaagaagca
gaaggtgttggaagagaagcagtaaggttagcgctttcgggtgtctctggagtaatggta
actattgaaagaataagtaatgatccatacaaggttgaatttaaaactgtagaattgaat
aaggttgcagaacagacaaaataccttccagaagattttcataacgaatttgaagtgact
gataaatttataaagtatgcaaaaccgttaattgagggagaatttttcccgccgtttaaa
aatggtcttcctgattatttgataattgaggaggtagagcagcaatag

DBGET integrated database retrieval system