KEGG   Thermosipho africanus: THA_94Help
Entry
THA_94            CDS       T00797                                 

Definition
chemotaxis protein CheR
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
taf  Thermosipho africanus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:taf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    THA_94
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    THA_94
Enzymes [BR:taf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     THA_94
Two-component system [BR:taf02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   THA_94
Bacterial motility proteins [BR:taf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    THA_94
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91221..92258)
Genome map
AA seq 345 aa AA seqDB search
MEEKKIRILIVDDSAFMRMVLKDVLEKEKDMQIVGIAKDGMEAIELAIKTKPDIITLDVE
MPKLNGIEALKEIMKRAPTRVIMVSSLTEEGADITITALELGAVDFITKPAGSISMNFRK
IAGDLIQKIRAAMQVDVKSLVRKATYTSKKLNLKSLVSSKIVVIGSSTGGPKSLDLVIPP
LPENYPAPIIIVQHMPAGFTKSLAQRLNKISNLYVKEAEEGDVLEPGKVYIAPGDYHLGI
KQHDKKSVVYLEKSEKINNVRPAVDFTLDKVAEIYKDKTIAVILTGMGKDGTKGAFKVKY
YKGIVIAESKETCVVYGMPKSVVEEGYADFELPAYKIPEKLVEIV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaaaaaaagataaggatattaattgttgatgattcagcatttatgagaatggtt
ttaaaggatgtattggaaaaagaaaaagatatgcaaattgtgggaattgcaaaagatggt
atggaagcgatagaacttgcgataaaaacaaaacctgatatcattactttggatgttgaa
atgcctaagttaaatggcattgaggcattaaaagaaataatgaaaagagcacctacgaga
gtaattatggtaagtagtcttactgaagaaggtgctgatattactattaccgcattggaa
cttggagcagtagattttattactaaaccggccggaagtatttcaatgaattttagaaaa
attgcgggtgacttaattcaaaagataagagcagcaatgcaagttgatgtaaagtcatta
gtgagaaaggctacttatacatctaaaaagttaaatttaaagagtttggtttcaagtaaa
attgttgtaattggatcatcaaccggtggaccaaaatcgttagatttggttattccacct
ctaccagaaaattatccagcacctataataatcgttcagcatatgcctgctggttttaca
aaatctttggctcaaagattaaacaaaatttctaacctttatgttaaagaagctgaagaa
ggtgacgttttagaacctggcaaagtttatattgctccgggagattatcatcttggaatt
aagcaacatgataagaagagtgtggtttaccttgaaaagagtgaaaagattaataatgtt
agacctgcagtagattttactcttgataaagttgcggagatttataaggataagacaatt
gcagttatattaactggaatgggaaaagatggaactaaaggagcattcaaggtaaagtat
tataaaggaatagttattgcagaatcaaaagaaacttgcgttgtttatggcatgccaaaa
tctgttgttgaggaaggatatgctgattttgagcttccggcatacaaaataccagagaaa
ttggtagaaattgtataa

DBGET integrated database retrieval system