KEGG   Thermosipho africanus: THA_94Help
Entry
THA_94            CDS       T00797                                 

Definition
chemotaxis protein CheR
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
taf  Thermosipho africanus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:taf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:taf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91221..92258)
Genome map
AA seq 345 aa AA seqDB search
MEEKKIRILIVDDSAFMRMVLKDVLEKEKDMQIVGIAKDGMEAIELAIKTKPDIITLDVE
MPKLNGIEALKEIMKRAPTRVIMVSSLTEEGADITITALELGAVDFITKPAGSISMNFRK
IAGDLIQKIRAAMQVDVKSLVRKATYTSKKLNLKSLVSSKIVVIGSSTGGPKSLDLVIPP
LPENYPAPIIIVQHMPAGFTKSLAQRLNKISNLYVKEAEEGDVLEPGKVYIAPGDYHLGI
KQHDKKSVVYLEKSEKINNVRPAVDFTLDKVAEIYKDKTIAVILTGMGKDGTKGAFKVKY
YKGIVIAESKETCVVYGMPKSVVEEGYADFELPAYKIPEKLVEIV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaaaaaaagataaggatattaattgttgatgattcagcatttatgagaatggtt
ttaaaggatgtattggaaaaagaaaaagatatgcaaattgtgggaattgcaaaagatggt
atggaagcgatagaacttgcgataaaaacaaaacctgatatcattactttggatgttgaa
atgcctaagttaaatggcattgaggcattaaaagaaataatgaaaagagcacctacgaga
gtaattatggtaagtagtcttactgaagaaggtgctgatattactattaccgcattggaa
cttggagcagtagattttattactaaaccggccggaagtatttcaatgaattttagaaaa
attgcgggtgacttaattcaaaagataagagcagcaatgcaagttgatgtaaagtcatta
gtgagaaaggctacttatacatctaaaaagttaaatttaaagagtttggtttcaagtaaa
attgttgtaattggatcatcaaccggtggaccaaaatcgttagatttggttattccacct
ctaccagaaaattatccagcacctataataatcgttcagcatatgcctgctggttttaca
aaatctttggctcaaagattaaacaaaatttctaacctttatgttaaagaagctgaagaa
ggtgacgttttagaacctggcaaagtttatattgctccgggagattatcatcttggaatt
aagcaacatgataagaagagtgtggtttaccttgaaaagagtgaaaagattaataatgtt
agacctgcagtagattttactcttgataaagttgcggagatttataaggataagacaatt
gcagttatattaactggaatgggaaaagatggaactaaaggagcattcaaggtaaagtat
tataaaggaatagttattgcagaatcaaaagaaacttgcgttgtttatggcatgccaaaa
tctgttgttgaggaaggatatgctgattttgagcttccggcatacaaaataccagagaaa
ttggtagaaattgtataa

DBGET integrated database retrieval system