KEGG   Thermosphaera aggregans: Tagg_0379Help
Entry
Tagg_0379         CDS       T01237                                 

Definition
AMP phosphorylase (EC:2.4.2.4 2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tag  Thermosphaera aggregans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tagg_0379
Enzymes [BR:tag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Tagg_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(348134..349657)
Genome map
AA seq 507 aa AA seqDB search
MEQRVKEYSVSVLDLNFGKPIVVLNEADARELGVTPGNILLIIHGDKQKTGVVMTTKTMV
NKGSLMVTNELANALGLKEGGAVGIKPLSIPPSFPALKKRLKGERLEESHYREIVKDVVE
GVYGEAEIAAFLVSQLFYEPTEEELTYLIKAMVETGSRIVFEEPANDVHSVGGVPGNSKV
ALITVPIVAASGLLIPKTSSRAITSPAGTADTVEVLARVDLTIDEIKDIVKKTKGVLAWG
GKLNLAPADDIFVNIERRLAIDPIYQMVASILSKKLAMGIERLVIDIPAGRGAKVQEVSK
ADEMAGIFIRQASKMNIALKVAITYGGQPIGLTTGPALEAREALSALITGKGSRSLVDKA
LLLAGLVLELSGRVPAGSGEEVAREIFLSGKAYEKFKEIIEAQGGDPNVKPEEIPIGKHS
YTLKSPLEGAVTHLDNAAITTLARACGAPYDKGAGVYLHAKVGYRVNKGDPLITLYSNSA
SRLETAVNLLSQTQPIIVEGMLLKTLP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaacaacgtgtaaaggaatacagtgttagcgttttagatcttaattttggaaaaccg
atagttgtattaaacgaggccgatgcccgggagcttggtgtaactccaggcaacattcta
ttaatcattcacggggataagcagaaaaccggagtagtaatgacaaccaagaccatggtt
aacaagggttcactaatggtgacaaatgagctggcaaacgccttaggcttgaaagaaggt
ggggctgtaggcattaaaccgttaagcatacctcctagttttccagcgctcaagaaaaga
ttgaaaggtgagagacttgaggaatctcattacagagaaattgttaaagatgtggtggag
ggggtttacggggaagccgagatcgcagcgtttcttgtaagccaattgttctatgaacca
acagaggaggaattaacttacttgattaaggcaatggtggaaacagggagcagaattgtt
ttcgaagagcccgctaatgatgttcacagcgttggtggcgtaccaggtaatagtaaagta
gcccttataactgttcccatcgttgcggcatcaggactattgatcccgaagacaagtagc
agggcgataacgagtcctgcaggaacagcggacactgttgaagtattagcaagagttgac
ttgacgattgacgagataaaggatattgttaaaaagacgaaaggggttttagcgtggggc
ggaaagcttaacctagcacctgctgacgatattttcgtaaacattgagagacgcctagca
attgatcctatttatcaaatggtagctagcatactctctaaaaagcttgcaatgggcatc
gagagactagttatagatatccccgctgggaggggtgcaaaagtacaggaggtgtctaaa
gctgacgagatggctggcatattcataaggcaggcgagtaaaatgaacattgctcttaaa
gtagcaataacttacggtggtcaaccaataggtttaacaaccggtccagccttggaggct
agagaagccttatccgcgttaatcacgggtaagggaagtcgtagtttagtggacaaagct
ttactactagcagggctcgtcttagagttaagcgggagggttccagccggaagcggtgaa
gaggttgccagagagattttcctttcagggaaagcctatgagaagtttaaggaaattata
gaggctcaaggcggagaccctaatgttaaaccggaggaaatccccatagggaaacactct
tacactctaaaatctcctcttgaaggagctgtaacccacctagataatgctgcgataaca
actcttgcaagggcttgcggagctccatatgataaaggagccggggtttatcttcacgca
aaggtcggttacagggtgaataagggagatccgttgataactctctacagtaacagcgcc
tcaaggcttgagactgctgtcaacctgctctcgcaaacccagcccataatcgttgaagga
atgttgttgaaaactctcccataa

DBGET integrated database retrieval system