KEGG   Thermosphaera aggregans: Tagg_0387Help
Entry
Tagg_0387         CDS       T01237                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tag  Thermosphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tagg_0387
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tagg_0387
   00020 Citrate cycle (TCA cycle)
    Tagg_0387
   00620 Pyruvate metabolism
    Tagg_0387
   00640 Propanoate metabolism
    Tagg_0387
   00650 Butanoate metabolism
    Tagg_0387
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tagg_0387
   00680 Methane metabolism
    Tagg_0387
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tagg_0387
Enzymes [BR:tag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tagg_0387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(356020..357273)
Genome map
AA seq 417 aa AA seqDB search
MSKLEVKYPSHMQEILNVNGNEAVAYAVKQSLVDVVSAYPITPQTIIVEKFSEFVADGLV
HTEFVPVESEHSAMSACVGAAAAGARTFTATSSQGLALMVEIVYIASALRLPIVMAVANR
ALSAPINIHNDHSDAYLMRDAGWVQLFTENVQETYDTTIQAFKIAEDERVLLPVAVNLDG
FFLSHTLENIRVLPDDAVAEFLGGYRKVAKLRVDYYDEQVPHMLNPARPLTFGSLDLYDY
YFEHKVQQIEAMKNVPAVVREVNEKWFALTGRKYGDGVIDAYGVEDAEIVIVAMGSGAGT
VRNVVKKYREKGEKLGLLRIRMFRPFPYEEVKGLLKDAKAVAVMDKGIGPGSFGALYQDV
VSSLYDLGSHPLIVDYVYGLGGRDLTPELVAKMIEQVKEDVKTGQVKEKIRYLGVRG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagctagaagttaaatacccatctcacatgcaggagattcttaacgtaaacggt
aacgaggctgtagcctatgctgttaagcaaagccttgtagacgttgtctcagcatatcct
atcaccccccaaacaatcattgtggagaaattctcagagttcgttgccgacggattggtt
cacacagagttcgtgccagttgaatccgagcactctgccatgagcgcctgtgtgggcgcg
gctgcggcaggagccagaaccttcactgctacgtcttcccagggccttgcgttaatggtt
gagatagtatatattgcatcagcgttaagacttcccatcgtaatggctgtggctaatagg
gctttatcggccccaatcaacattcacaacgaccacagtgacgcatacctgatgagggac
gcaggctgggttcaactctttaccgaaaatgttcaggaaacatatgacacgaccatacag
gccttcaaaatagctgaggatgaaagagtattactgcccgtggcagtaaaccttgacgga
ttcttcctcagccacaccctcgaaaacattagagtgctcccagatgacgctgtggccgag
ttcctcggcggatacaggaaggtggcaaaacttagggttgactactatgatgagcaagtg
cctcacatgttgaacccggcacgcccgctaaccttcgggtccctggatctctatgattac
tacttcgagcacaaggttcaacaaatagaagcgatgaaaaatgttccagcagtggtgagg
gaggttaacgagaaatggttcgcgttaacagggaggaagtacggagatggagtaatagat
gcttacggcgttgaggatgctgaaatagtcatagtagccatgggcagtggtgcaggaact
gtaaggaacgttgtaaagaagtacagagagaaaggggagaagctgggattattgaggatc
agaatgttcagacccttcccatacgaggaggttaaaggtcttcttaaggatgcaaaagcg
gtggcagtaatggataaaggaatcggcccagggagctttggagccttataccaggatgta
gtgagtagcctatacgatcttggctctcacccattaatcgtggactacgtgtacgggcta
ggaggtagggatctcaccccagagctcgttgcaaaaatgattgagcaggtgaaagaagac
gtgaaaacgggtcaggttaaagaaaagataagatacctgggggtgagggggtaa

DBGET integrated database retrieval system