KEGG   Thermosphaera aggregans: Tagg_0388Help
Entry
Tagg_0388         CDS       T01237                                 

Definition
pyruvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tag  Thermosphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tagg_0388
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tagg_0388
   00020 Citrate cycle (TCA cycle)
    Tagg_0388
   00620 Pyruvate metabolism
    Tagg_0388
   00640 Propanoate metabolism
    Tagg_0388
   00650 Butanoate metabolism
    Tagg_0388
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tagg_0388
   00680 Methane metabolism
    Tagg_0388
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tagg_0388
Enzymes [BR:tag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tagg_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(357278..357559)
Genome map
AA seq 93 aa AA seqDB search
MSSQRGWKELPLGGIAYRLSTDVKTGDWRALKPVVDHNKCTKCMLCWLFCPDMAIVWDGE
KIQVNYDYCKGCGICAHECPVKAISMIPEFEEV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtcaaagaggctggaaagaactcccattaggcgggatcgcttacaggttgtca
actgatgttaagacaggtgattggagagcccttaagccagtcgtagaccacaacaagtgc
acgaaatgcatgctttgttggctcttctgcccagacatggctatcgtgtgggacggagag
aagatacaggtcaactatgactactgcaagggatgtggaatatgtgctcacgaatgtcct
gtgaaagcaatatccatgatacctgagttcgaggaggtgtga

DBGET integrated database retrieval system