KEGG   Thermosphaera aggregans: Tagg_0412Help
Entry
Tagg_0412         CDS       T01237                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
tag  Thermosphaera aggregans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
380263..381363
Genome map
AA seq 366 aa AA seqDB search
MSWREELLLLIKELTQLPGPSGYEHRVRDKVVELVKPYADRLWIDAWGNVIAVKKGKTSD
RRLMLAAHMDEIGLFVSHIEDDGFLRAIPIGGVLERTLLYQRVIVVTRTGRMIRGVIGLK
PPHVIKPEEAQKVPELRELFIDIGASSKEEVEKLGVRNGDIVVFDRDVSELSGNRITGKA
FDDRVGVAVLIKALEMMGQPEVDAYFVFTVQEEVGLKGARTSAYGITPDVALAVDVTIAS
DVPGVAKSEWFTRLGRGPAIKIVDGRNATGLIAHPKVVDFLVTLAEKHKIPYQLDVVPGG
TTDASIIALNKDGVPAGTVSIPSRYIHSPVEVLDLEDVYNASKLAAAFASEATEEWIKSL
KGMVIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggagagaggaattattactcttaataaaggagttaactcaattaccggggcca
agcggttatgaacacagggttagggataaggttgtcgagctggtaaagccgtatgcggat
agactatggattgatgcgtggggaaacgtgatagctgttaagaagggcaagaccagcgat
agaagactaatgctagcagcacacatggatgagatagggttattcgtttcccacatcgag
gacgatgggttcttgagggcgataccaataggaggagttctcgagagaaccctcctctac
cagagggtcattgttgtaacaaggaccggccggatgattcgcggggttataggattgaag
cctccgcacgtcataaagcccgaggaggctcagaaggtcccagagctaagggagttgttt
atagacataggggcttcttcaaaggaggaagtagagaagctcggcgttagaaacggagat
attgtagttttcgatagggatgtatccgagctctcaggtaaccgcataacaggcaaggcc
ttcgatgacagggttggggttgctgtgttgattaaagcgttggaaatgatgggtcagccc
gaagtggacgcgtacttcgtgttcacggtgcaggaagaagtaggattaaaaggtgctaga
acatcagcctacggtataacacccgacgtggcgttagcggtggacgtcactattgcgagc
gacgtacctggcgtggccaagagtgagtggtttaccaggcttggaagagggcctgccatt
aaaatcgttgatggaaggaatgcaacgggcttaattgctcatccgaaagtagtagacttc
ctggtcactctggccgagaagcataaaataccctaccagctcgatgttgttcccggaggc
actacagacgcttctattatagccttgaacaaggatggtgttcccgctggaacagtctcc
atcccatccagatacatccatagccctgtggaagtgttggatctagaggatgtttataat
gcgtcgaaacttgccgcagcatttgcttcggaagccactgaggaatggattaaaagcttg
aaggggatggtcatcaaatag

DBGET integrated database retrieval system