KEGG   Thermosphaera aggregans: Tagg_0486Help
Entry
Tagg_0486         CDS       T01237                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tag  Thermosphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tagg_0486
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tagg_0486
   00052 Galactose metabolism
    Tagg_0486
   00500 Starch and sucrose metabolism
    Tagg_0486
   00520 Amino sugar and nucleotide sugar metabolism
    Tagg_0486
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tagg_0486
   00524 Butirosin and neomycin biosynthesis
    Tagg_0486
Enzymes [BR:tag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tagg_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(454159..455127)
Genome map
AA seq 322 aa AA seqDB search
MKYYIAIDLGASKTRIAVCSKDSIIKKIVEATPKHGDEYAIAKFIWESTRKSFSEYIEDI
VAVGVASIGPLDIKRGVAVNPTNLPFKEIKLLEPLTKYFNTKVVVANDAMAAAWGEKHYG
LGKPFRNLVYLTLSTGVGAGVIVDGHLLIGKEGNAHEVGHIIVDFNSELECGCGGRGHWE
AFAGGINIPRVARWIAVKHGISSDLFDFLLKHPEASAKDVFEYYRRGDPLGVLVVDLYVK
ASRAGIASIINIYDPEILLIGGGVFLNNQDILFEKIVNGLENDIVTSMPIIKPTGFGDDA
GLYGALALAVNPPRELLEEQGV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatattgcaatagacctcggcgcttccaagactcgaatagcggtttgttct
aaagactcgatcattaaaaaaatcgtggaggcaactcctaaacatggggatgaatatgct
attgcgaaattcatatgggagagtacgaggaagagtttttcggaatacattgaagatatc
gtagcggtgggagttgcgtccataggcccgttggacataaagagaggggttgctgtaaac
ccgacaaatctcccgttcaaggagataaaactactggagcctttaacgaaatatttcaat
acaaaggtagtggtggcaaacgacgccatggctgctgcttggggcgagaagcactatgga
ttgggaaaacctttcagaaaccttgtctacctaacgcttagtacgggagtcggcgcggga
gttatagttgatgggcacttattgataggtaaagaaggcaatgcccacgaggtaggtcac
attatcgttgacttcaactccgaactggaatgcgggtgtggcggtagagggcactgggag
gcgttcgctggcgggataaacataccgagggtggcgagatggattgctgtgaaacacggg
attagttcagacctgtttgatttcttgttgaagcaccctgaagcgtcggcgaaggatgtt
ttcgaatactataggcgaggggatcccttgggcgtgttagtagttgacttgtatgttaaa
gcctcgagagcgggtattgcctcaattataaatatatatgacccagaaatcctattgata
gggggcggggtattccttaacaatcaggacattcttttcgagaagattgtaaatggattg
gagaatgatatcgtcacctcgatgccaattatcaaaccaacaggttttggagacgatgca
ggcctttacggggctttagctctagcggttaatcctccgcgcgagcttctagaagaacaa
ggcgtttga

DBGET integrated database retrieval system