KEGG   Thermosphaera aggregans: Tagg_0486Help
Entry
Tagg_0486         CDS       T01237                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tag  Thermosphaera aggregans
Pathway
tag00010  Glycolysis / Gluconeogenesis
tag00052  Galactose metabolism
tag00500  Starch and sucrose metabolism
tag00520  Amino sugar and nucleotide sugar metabolism
tag00521  Streptomycin biosynthesis
tag01100  Metabolic pathways
tag01110  Biosynthesis of secondary metabolites
tag01120  Microbial metabolism in diverse environments
tag01130  Biosynthesis of antibiotics
tag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tagg_0486
   00052 Galactose metabolism
    Tagg_0486
   00500 Starch and sucrose metabolism
    Tagg_0486
   00520 Amino sugar and nucleotide sugar metabolism
    Tagg_0486
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tagg_0486
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tagg_0486
Enzymes [BR:tag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tagg_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA
Motif
Other DBs
NCBI-ProteinID: ADG90761
JGI: Tagg_0486
UniProt: D5U0W1
Position
complement(454159..455127)
Genome map
AA seq 322 aa AA seqDB search
MKYYIAIDLGASKTRIAVCSKDSIIKKIVEATPKHGDEYAIAKFIWESTRKSFSEYIEDI
VAVGVASIGPLDIKRGVAVNPTNLPFKEIKLLEPLTKYFNTKVVVANDAMAAAWGEKHYG
LGKPFRNLVYLTLSTGVGAGVIVDGHLLIGKEGNAHEVGHIIVDFNSELECGCGGRGHWE
AFAGGINIPRVARWIAVKHGISSDLFDFLLKHPEASAKDVFEYYRRGDPLGVLVVDLYVK
ASRAGIASIINIYDPEILLIGGGVFLNNQDILFEKIVNGLENDIVTSMPIIKPTGFGDDA
GLYGALALAVNPPRELLEEQGV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatattgcaatagacctcggcgcttccaagactcgaatagcggtttgttct
aaagactcgatcattaaaaaaatcgtggaggcaactcctaaacatggggatgaatatgct
attgcgaaattcatatgggagagtacgaggaagagtttttcggaatacattgaagatatc
gtagcggtgggagttgcgtccataggcccgttggacataaagagaggggttgctgtaaac
ccgacaaatctcccgttcaaggagataaaactactggagcctttaacgaaatatttcaat
acaaaggtagtggtggcaaacgacgccatggctgctgcttggggcgagaagcactatgga
ttgggaaaacctttcagaaaccttgtctacctaacgcttagtacgggagtcggcgcggga
gttatagttgatgggcacttattgataggtaaagaaggcaatgcccacgaggtaggtcac
attatcgttgacttcaactccgaactggaatgcgggtgtggcggtagagggcactgggag
gcgttcgctggcgggataaacataccgagggtggcgagatggattgctgtgaaacacggg
attagttcagacctgtttgatttcttgttgaagcaccctgaagcgtcggcgaaggatgtt
ttcgaatactataggcgaggggatcccttgggcgtgttagtagttgacttgtatgttaaa
gcctcgagagcgggtattgcctcaattataaatatatatgacccagaaatcctattgata
gggggcggggtattccttaacaatcaggacattcttttcgagaagattgtaaatggattg
gagaatgatatcgtcacctcgatgccaattatcaaaccaacaggttttggagacgatgca
ggcctttacggggctttagctctagcggttaatcctccgcgcgagcttctagaagaacaa
ggcgtttga

DBGET integrated database retrieval system