KEGG   Thermosphaera aggregans: Tagg_0535Help
Entry
Tagg_0535         CDS       T01237                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tag  Thermosphaera aggregans
Pathway
tag00300  Lysine biosynthesis
tag01100  Metabolic pathways
tag01120  Microbial metabolism in diverse environments
tag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tagg_0535
Enzymes [BR:tag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tagg_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 PIF6
Motif
Other DBs
NCBI-ProteinID: ADG90809
JGI: Tagg_0535
UniProt: D5U109
Position
complement(506162..507370)
Genome map
AA seq 402 aa AA seqDB search
MKNVFEISQRILVNSVKYPTILGDYYEELIYYYADELSKYGIHTTVHQVPKEYCEKVLPK
QFNPEKPRYILIARVGSGEKVLQFNGHYDVVAAGGGWSTDPFNPVITNGKIYGRGTTDMK
AGIAAFLATMIYFATTSKEPNIVVEGAVVPDEEIGGATGTGYLVNVLGSRPDFAVIAEPS
GAGNIYIGHRGNVWAMIRVRGKQAHGSTPWLGENAFEKMIILADYFVKKYKPLLEARKST
LKYEDPRASFPTITLGGKLEAPGSINIVPGQVGFSIDRRLIVEERAEQVIDELRKFVESA
SKELGIESEVEIVDYSNPVYVEENHPYVNSLARTVKEALGVEPTRTICVGGLDLKYYLAK
GIPAVAYGPGEVNMAHKADEFVTLESLYNSIKVYIKLVESFI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatgtattcgagatctcccagagaatcctggtcaatagtgtgaaatacccaact
attctcggagattattacgaggagctcatatactattatgcagatgagttatcgaagtat
gggattcacaccacggttcatcaagtacccaaagaatactgcgaaaaagttctccctaaa
cagttcaaccctgagaagcctagatatattctgatagcccgcgtagggagcggtgagaag
gtcttacagtttaatgggcactacgatgtcgtagcggcaggcggcggctggtcaaccgac
ccgtttaatcctgtgatcactaatggaaagatttacgggcgcggaacaacggatatgaag
gcgggcattgcggccttcttagccaccatgatatattttgctacaacgagtaaagagccc
aacatcgttgttgaaggagccgttgtacccgacgaggaaatcggtggggcaactggcacg
ggctacttggtgaatgtgcttgggagcaggcctgatttcgcagtgatagccgagccgtca
ggagccgggaacatctacattgggcatagaggtaacgtgtgggctatgatcagggttcgt
gggaaacaagcacatggttcaactccgtggcttggtgaaaacgctttcgagaaaatgatt
attctcgcagactatttcgtgaaaaaatacaagccgttgctggaagctaggaagagcact
ttaaaatatgaggatccccgtgcatcattcccaactattaccctggggggaaaactggaa
gcacctggctctatcaacatcgtccccggacaggtgggattcagtattgatagaaggttg
atagttgaggagagagccgaacaggttattgacgagctgagaaaatttgtcgaatcagcc
tcgaaagaactaggaatagaaagcgaggtggaaatagtcgattactctaaccccgtttac
gttgaggagaatcatccatatgttaactctctggctcggacggtgaaggaggcactggga
gtcgagcctacgcggaccatttgcgtggggggtttggacttaaagtattacctagctaaa
ggaatccccgcagtagcatatggtcccggagaggtaaacatggctcataaggcagacgag
ttcgttaccctggaaagcttgtataattctataaaagtctacattaaactggttgaatca
ttcatttaa

DBGET integrated database retrieval system