KEGG   Thermosphaera aggregans: Tagg_0553Help
Entry
Tagg_0553         CDS       T01237                                 

Definition
(GenBank) cytidine kinase; inosine-guanosine kinase; 6-phosphofructokinase (EC:2.7.1.73 2.7.1.- 2.7.1.11)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
tag  Thermosphaera aggregans
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tagg_0553
Enzymes [BR:tag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tagg_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(529252..530172)
Genome map
AA seq 306 aa AA seqDB search
MSSIDVVTVGHALVDIRILVEAFPGIDLESKVLEQSWGSGGSAVNVAIGVRRLGLKSSIL
AKIGFDSFGRIIVDDLLKEGVDISGLRISLGQTGFTIVAINKKGEITMYGYKGAAETLEP
SDLSEYAISRAKWIHIASLRLDTTIEALRIAEKYGLKSSWDPGRVLASQGLEKLKPVVSR
VNVVFLNHKEASLLTGIEDYKEAAKEIASTGPEIVIVKRGEKGVYVYSKELQEEIPAYKV
DNVIDTTGAGDAFASGFITGFLRGYSLRKSLQYGNAVAALKISSLGSHCVPTHDEVVKFI
WEREGI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcatagacgttgtgacagtagggcatgctctagtagacataaggattttagtg
gaggcttttccagggatagatctcgagagtaaagtcctcgagcagtcctgggggagcggc
ggctcagccgttaacgttgccattggggttagaaggctgggcttgaagtcgagcattcta
gcgaaaatcggtttcgacagtttcgggagaataatagttgacgacttgttgaaggagggc
gtggatataagtggtttaaggataagcctgggccaaacagggttcaccatagtcgctatt
aacaagaagggggaaatcacgatgtacgggtataaaggcgcggctgagacgcttgagccc
tcagacctcagtgagtacgcgatttcaagggctaaatggattcacatagcaagcttgaga
ctggatacaacgattgaggctctcaggattgctgaaaaatacgggttgaagtcttcatgg
gatcctggaagagtactggcatcacaggggttggagaagctgaaaccagttgtatcccgg
gtcaacgttgtcttcctgaatcataaggaagcatcactgttaaccggtattgaagactac
aaggaagcagccaaagagatcgcttcaaccgggccggagatagtgatcgtgaaaagaggc
gaaaaaggagtatatgtttacagtaaggagctacaggaggagataccggcttacaaggtt
gacaacgtgattgacaccaccggggccggggacgctttcgcatcagggttcataacgggc
tttctaagaggttatagtttgagaaaatcccttcaatacggtaatgccgtggctgcgttg
aaaatttcaagcctcggctcccactgtgtgccaactcatgatgaagttgtaaagtttatc
tgggaaagagaaggaatttaa

DBGET integrated database retrieval system