KEGG   Thermosphaera aggregans: Tagg_0726Help
Entry
Tagg_0726         CDS       T01237                                 

Definition
branched-chain acyl-CoA synthetase subunit alpha (EC:6.2.1.13 6.2.1.-)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
tag  Thermosphaera aggregans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tagg_0726
   00620 Pyruvate metabolism
    Tagg_0726
   00640 Propanoate metabolism
    Tagg_0726
Enzymes [BR:tag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Tagg_0726
Lipid biosynthesis proteins [BR:tag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tagg_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(686867..688237)
Genome map
AA seq 456 aa AA seqDB search
MVKALFEPKSIAVVGASRSPGKIGHVVLKNIKFYGYSGKIYPVNPNADEILGLKAYPSIS
SIPDEVDVAVITVPAQEVPPVIEECARKGVKVAVVITAGFSEVGNVEVEEKMVETARKYG
MRILGPNIFGYAYTPLNINATFGPLELSKGNIAFITQSGALGIALMGWTIMNEIGLSALV
SVGNMADLDVIELSEYLADDPHTKVITIYLEGLKPGYGREFVERMRKVTRKKPVIVIKAG
RTQRGASAAASHTGSLAGSDSLYEAAFKQAGIIRTYTVEDMFDVARAFALQPLPKGDRTI
IITNGGGVGVLATDAAELNNVKLIDPSPELKEKLKASMPWFGSPKNPVDLTGQAVADNYL
KALKAALDSKEVDNVVLLYCRTAILDPRELAKAIVEFYQSNSGGKPIVAGFVGGEDTYEA
IRYLNRNGIPAYGAPERAVYALSRMIWYSKYVSSSK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagccttgttcgaacctaaaagcatagcagtagtaggtgcgagcaggtctcca
ggcaagattggtcacgtggttcttaagaacattaaattctatggttattcggggaagata
tatccggttaacccgaacgcggatgaaatcctggggttgaaagcgtatccttcaatttca
agcattcccgacgaggttgacgtagcggttatcacggtgccagcgcaggaagttcccccc
gtcatagaggagtgtgcgcgtaaaggtgttaaagtagcggtagttataacagccggtttc
tcagaagttggaaatgttgaagtcgaggagaaaatggttgagacagctaggaagtatggt
atgaggattctggggccgaacatattcggctacgcctatacaccgttaaacattaatgca
acgttcgggccactcgaactttcaaaaggcaatatagcgtttatcactcagagcggggca
ctgggtattgcgctgatgggttggactataatgaacgagataggcttatcagccctggta
agcgttggcaacatggctgacctagacgttatcgagctctcggaataccttgcagacgac
ccccacaccaaagtgataactatctacctagaaggtttgaagccagggtatggaagagag
ttcgttgagagaatgagaaaagtgactcggaagaagcctgtaatagttatcaaagccggt
agaacccagagaggcgcttccgcagcagccagccacaccgggagtttagccggtagcgac
tcactttatgaggccgctttcaagcaggcaggaatcattagaacatacactgtcgaagac
atgttcgatgttgcaagagccttcgccctccaaccactccctaagggtgacagaacgatc
attatcactaacgggggaggtgtaggcgtgttagctactgatgcagccgagttaaacaac
gtgaagctcattgacccatcccctgagttgaaggaaaagcttaaagcctccatgccctgg
tttggtagccctaagaaccccgttgacctaacagggcaggctgtggccgataactacttg
aaagcgttgaaggccgcacttgattctaaagaagttgacaatgtagtgttgctgtattgt
aggacagcaattcttgatccgagagagctcgctaaggcgattgtggagttttaccagtct
aacagtggcggtaagcctatagtggccggattcgtgggcggtgaagacacttatgaagct
ataaggtatttgaatagaaatggaataccggcttacggggctcctgagagagctgtgtac
gccttgtcgagaatgatatggtatagtaaatacgtttcctcttccaagtaa

DBGET integrated database retrieval system