KEGG   Thermosphaera aggregans: Tagg_1018Help
Entry
Tagg_1018         CDS       T01237                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tag  Thermosphaera aggregans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tag01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tag00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tag00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
952209..953339
Genome map
AA seq 376 aa AA seqDB search
MKLYEYESKDIARKYGVQTPRGVLASSPEEALRAAEEFGAVVLKSQVLVGGRGLAGGILK
AESPAEAYMKAKELLGKMIKGERVEKLLVEEKICVAREYYVSITVDRATKQITYLVSSMG
GVEIEELARKHPEKIKRMSVDPSIGYLGYMGREAAVFMELPWSLSNQVDHVLSAMYRIMI
DYDAELVEFNPLALTCDNKLIALDAKIIVDDNSLFKHPELQALYGRGLTPYERKAKELGF
NYVELDGDIGVISNGAGLTMATMDAILYYGGRPANFLDIGGGAGRERVKEAVKLLLTHPK
VKALLVNIFGGITRCDEVAHGVLEALAEAGVSKPVVVRMLGTNEEEGRRILSEKGITVYS
EMDEAVRKIVEYSRGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctctacgagtatgagtccaaggatattgccaggaaatacggggttcaaaccccg
cgtggagtactcgcatccagtcctgaggaggctttgagagcggctgaagagttcggtgcc
gtcgtgttgaaatcccaggtattagtgggaggcaggggtcttgcaggaggtattttaaag
gctgaaagtcccgcggaggcttatatgaaagctaaggagcttctcggcaagatgatcaag
ggtgagagggttgaaaaactcctagtggaggaaaagatttgcgtagcccgggagtactac
gtatcgataaccgtggacagggctacaaagcagatcacttatcttgtctcctccatgggt
ggcgtggagattgaggagcttgcgaggaaacatcccgagaaaatcaaaaggatgagcgtg
gacccctctatcggatacttgggatacatggggagggaggccgcggtcttcatggagctt
ccatggagtcttagcaaccaggttgaccatgttttatcggcaatgtacaggataatgata
gattatgacgcggagctggttgagttcaaccctctcgcactcacatgtgataataagctt
atcgctctcgacgctaaaatcatagtggatgataacagcttgtttaaacaccctgagttg
caagccctctatgggaggggtctcacgccttacgagagaaaagccaaggaactcggcttc
aactatgttgagctggatggggatataggggtgatcagcaatggcgcgggcctcacaatg
gccacaatggacgctattctctactatggtggtaggccggctaacttcctcgacatagga
ggaggggctgggagggagagggttaaggaagctgttaagctactacttacacaccccaag
gtgaaagccctgctggtgaatattttcggaggcataaccaggtgtgacgaggttgctcac
ggtgttttagaggctttggcggaggcaggtgtttcaaaacccgtagttgtcagaatgctt
ggaaccaatgaggaagaggggaggaggattttatccgagaaaggcattaccgtctactct
gaaatggatgaggcggtgagaaaaatcgtcgagtactcgagaggtggttga

DBGET integrated database retrieval system