KEGG   Thermosphaera aggregans: Tagg_1018Help
Entry
Tagg_1018         CDS       T01237                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tag  Thermosphaera aggregans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tagg_1018
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tagg_1018
   00640 Propanoate metabolism
    Tagg_1018
   00660 C5-Branched dibasic acid metabolism
    Tagg_1018
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tagg_1018
Enzymes [BR:tag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tagg_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
952209..953339
Genome map
AA seq 376 aa AA seqDB search
MKLYEYESKDIARKYGVQTPRGVLASSPEEALRAAEEFGAVVLKSQVLVGGRGLAGGILK
AESPAEAYMKAKELLGKMIKGERVEKLLVEEKICVAREYYVSITVDRATKQITYLVSSMG
GVEIEELARKHPEKIKRMSVDPSIGYLGYMGREAAVFMELPWSLSNQVDHVLSAMYRIMI
DYDAELVEFNPLALTCDNKLIALDAKIIVDDNSLFKHPELQALYGRGLTPYERKAKELGF
NYVELDGDIGVISNGAGLTMATMDAILYYGGRPANFLDIGGGAGRERVKEAVKLLLTHPK
VKALLVNIFGGITRCDEVAHGVLEALAEAGVSKPVVVRMLGTNEEEGRRILSEKGITVYS
EMDEAVRKIVEYSRGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctctacgagtatgagtccaaggatattgccaggaaatacggggttcaaaccccg
cgtggagtactcgcatccagtcctgaggaggctttgagagcggctgaagagttcggtgcc
gtcgtgttgaaatcccaggtattagtgggaggcaggggtcttgcaggaggtattttaaag
gctgaaagtcccgcggaggcttatatgaaagctaaggagcttctcggcaagatgatcaag
ggtgagagggttgaaaaactcctagtggaggaaaagatttgcgtagcccgggagtactac
gtatcgataaccgtggacagggctacaaagcagatcacttatcttgtctcctccatgggt
ggcgtggagattgaggagcttgcgaggaaacatcccgagaaaatcaaaaggatgagcgtg
gacccctctatcggatacttgggatacatggggagggaggccgcggtcttcatggagctt
ccatggagtcttagcaaccaggttgaccatgttttatcggcaatgtacaggataatgata
gattatgacgcggagctggttgagttcaaccctctcgcactcacatgtgataataagctt
atcgctctcgacgctaaaatcatagtggatgataacagcttgtttaaacaccctgagttg
caagccctctatgggaggggtctcacgccttacgagagaaaagccaaggaactcggcttc
aactatgttgagctggatggggatataggggtgatcagcaatggcgcgggcctcacaatg
gccacaatggacgctattctctactatggtggtaggccggctaacttcctcgacatagga
ggaggggctgggagggagagggttaaggaagctgttaagctactacttacacaccccaag
gtgaaagccctgctggtgaatattttcggaggcataaccaggtgtgacgaggttgctcac
ggtgttttagaggctttggcggaggcaggtgtttcaaaacccgtagttgtcagaatgctt
ggaaccaatgaggaagaggggaggaggattttatccgagaaaggcattaccgtctactct
gaaatggatgaggcggtgagaaaaatcgtcgagtactcgagaggtggttga

DBGET integrated database retrieval system