KEGG   Thermosphaera aggregans: Tagg_1191Help
Entry
Tagg_1191         CDS       T01237                                 

Definition
family 4 glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tag  Thermosphaera aggregans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tagg_1191
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tagg_1191
   00600 Sphingolipid metabolism
    Tagg_1191
Enzymes [BR:tag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tagg_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107587..1108972
Genome map
AA seq 461 aa AA seqDB search
MGSPGKSLKISIIGAGSAVWSTRILVDIMLKKNLQGAKVYLMDIDEDRLKLVYLFAKRYA
SEIHADVEFHATTDRIEAIRDSAFVINSAMAKGHRYYEMMREATERKGYYRGINSVEWNM
VSDYHTIWGYYQFKLAVSIARDIEEYAPDAWLINVANPVFELTTLLSRITKVKNIGICHG
HMEFWNIVRELRLDPSKVEAEMSGFNHVIWLTRFKYDGLDGYELIDKWIKEEAEKYWRKW
WATTSNPFDIQLSPAAVDMYLKYGMFPIGDTVRGGTWKYHWNLETKKKWYGPYGGPDSEV
GWALYTTYLAYQMEMIKGFVQAESAPLTMLIPPKPSGEQVIDITESIAADVLRKYQVNIL
NNGLIPGIPDNVAVEVPAVIDGQGVRRISVTPPNNRVLKHVLLPRMMRMEWALHAFLEPS
KDALLEWLMYDVRTRSVSQAEEAIDAMLKLPGNEEMAEVFK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgggttctccgggcaaatcattaaaaatatccatcatcggggcaggctccgcggtatgg
tccacgaggattctcgttgacattatgcttaagaagaatctccagggggctaaggtatat
ttgatggatattgatgaagataggttaaaactggtttacctttttgcgaagaggtatgcc
agtgaaatccacgctgatgtggagtttcacgctactacagaccgcatcgaggcgataagg
gactcggccttcgtaatcaacagtgcaatggctaaggggcatagatattatgaaatgatg
agggaggctacggaaagaaaaggttactacagagggataaacagcgtcgagtggaacatg
gtgagtgattatcatacgatatggggttactatcaattcaagcttgcggtgagcattgca
agagatattgaggaatacgcgccggacgcgtggctcatcaatgttgcgaaccccgtgttc
gagctaacaaccctgctgagcaggatcactaaggttaagaacataggcatatgccacgga
cacatggagttctggaatattgttagagaactacgtcttgacccctcaaaagttgaagca
gaaatgtcaggattcaaccatgtaatttggcttacaagatttaaatacgatggcctcgac
ggttacgagttgatagacaaatggattaaggaagaggctgaaaaatactggaggaaatgg
tgggcaaccacgagcaacccgttcgatattcagctatcgcccgccgcggttgacatgtat
ttgaagtatgggatgttccctataggagatacggtgagaggaggtacttggaagtaccat
tggaacctggagactaagaaaaaatggtacggcccatacggtgggcccgactcggaggta
gggtgggcgctctacacgacttacctagcttatcaaatggagatgatcaagggcttcgtg
caggccgagagcgctccattaacaatgcttataccgccgaagcccagcggggagcaggtc
atcgacatcacagagtcgatcgcggctgatgttctgcggaaatatcaagtcaatatcttg
aacaatgggttgatccccggaatacctgacaatgtcgcagtagaggttccagcagtaata
gacggtcaaggcgtgagaagaatcagtgtcaccccacctaacaacagggttttgaagcat
gtgctactcccgagaatgatgagaatggaatgggctcttcacgctttcctcgaaccgagc
aaggatgccctgctggaatggttaatgtatgatgtgagaacaaggtctgtctctcaggct
gaggaggcaatagatgctatgctgaaactacccggcaacgaggagatggcagaggtattt
aagtag

DBGET integrated database retrieval system