KEGG   Thermanaerovibrio acidaminovorans: Taci_0033Help
Entry
Taci_0033         CDS       T01129                                 

Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00340  Histidine metabolism
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Taci_0033
Enzymes [BR:tai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Taci_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 8629843
NCBI-ProteinID: YP_003316555
UniProt: D1B7M0
Position
complement(40717..41991)
Genome map
AA seq 424 aa AA seqDB search
MKVLKSPRVKDRASSSDLYGVSHEVRRIIDWVVLHGDRAVLEGSRLHDRSSRDSILVPVE
ELQRAHRSMDPELLEAVRYAASNVETFAQRQKGALMPLEESEVRDGVYLGHRVVPVDSCG
IYIPGGSYPLISTAVMLAVPARVAGVGRICACTPVRRGTNSPDPSVLGTLYELGVTEVYA
AGGAYAVAAMAHGTESIPPVDVIVGPGNKYVTEAKRQCFGKVGIDFVAGPSEVLIIAQEG
DPDFIAWDLLAQAEHDPDAKGVLVTTSPALARQVMDRVETILGEIVTSPVARSSWEDHGE
VLAAEGMDEAVEFSNRMAPEHLELMVQDPDRWIPRLRNYGALFIGEHSAEVFGDYASGSN
HTLPTAGASRYTGGLWVGTFLKVLTSQRVTREGARELARVSALLAQAEGLMAHRGAALAR
SRKG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgttgaaatctccaagggtgaaggaccgggcctccagctcggacctgtacggg
gtgagccatgaggtgcggcggataatcgactgggtggtgctccacggggaccgggcggtg
ctggagggctcccgactacacgacagatcctcccgggacagcatcctggtgcccgtggag
gagctccagcgggcccaccggtccatggatccggagcttctggaggcggtccggtatgcg
gcctccaacgtggagaccttcgcccagcgacagaagggggccctgatgcccctggaggaa
tcggaggtccgggatggggtgtacctgggtcaccgagttgttccggtggactcctgcggc
atctacatccccgggggctcgtacccccttatctccaccgcggtgatgctggcggtgccc
gcccgggtagctggggtgggccgcatatgcgcctgcacccccgtgaggcgcggcaccaac
tccccggatccgtcggtcctggggaccctctacgagctgggggtaacggaggtgtacgcc
gccgggggggcctacgcggtggccgccatggcccacgggaccgagtcgatcccgccggtg
gacgtgatcgttggcccgggcaacaagtacgtcaccgaggccaaacggcagtgcttcggc
aaggtgggcatcgacttcgtggcgggccccagcgaggtgctcataatcgcccaggagggg
gatccggacttcatcgcctgggacctcctggcccaggcggagcacgacccggacgccaag
ggggtgctggtgaccacctcccctgccctggcccggcaggtgatggaccgggtggagacc
atactgggggagatagtgacctccccggtggcccggtcctcctgggaggaccacggggag
gtgctggcggcggaggggatggacgaggcggtggagttttccaaccggatggcaccggag
cacctggagctgatggtccaggacccggaccggtggataccgcgccttcggaactacgga
gcccttttcatcggggagcactccgcggaggtcttcggggactacgcctcggggagcaac
cacacgttgcccaccgccggggcatcccggtacaccggtgggctatgggttggaacgttc
ctcaaggtgctgacctcccagcgggtgacccgggagggggcccgggaactggcccgggtc
tccgccctcctggcccaggcggaggggctcatggcccaccggggggcggcgcttgcgaga
tcccggaaggggtga

DBGET integrated database retrieval system