KEGG   Thermanaerovibrio acidaminovorans: Taci_0043Help
Entry
Taci_0043         CDS       T01129                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tai00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51982..53466)
Genome map
AA seq 494 aa AA seqDB search
MIWLTGGGCASPRWLTQEGAEALGSASAVVYDRLIHPDLLLLCPPGALFIQAGKRGSDHT
MSQEEINRLLVELAADHPHVVRLKGGDPFVFGRGGEEAQELDRHGIPWRAVPGVTAALGG
LLKEGIPVTHRGAASAVCLATGHLEAPSESYWGSLARFDGSRVLYMSASNLPENLGRLIS
LGLPENEPCVAVTWGGWGRSYVVGGTAGEGARGGWASQVRSPSVVMIGGSARVRLTPAEL
PLKGLTVAVCRPMPEGYQTARRLEALGADAFTLPLLEVRPTASREELLASLEGADTVVFT
SPRGPKVFRDLVMDLRLLRCRTVAIGEGTRRSLEEMGIGVDLMPERADSRSLAELLVSCV
RPGERILFLRNRRCSPLPVEAVRRAGALALELPIYEMVPRGLPWRELILEHWQDTRPHAV
VFGSAALAEAFADEFGPLPAGAVPVAWGEECAKRCGELFRRRGVVMASQDLDGLVSALLE
IRGSEHPPKHRGRG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatatggctgacagggggcggctgtgcctccccccggtggctaacccaggagggggcg
gaggccctggggtccgcatcggcggtggtctacgaccggctgatccacccggacctgctt
ctcctctgcccccccggggccctgttcatccaggcggggaagcggggctcggaccacacc
atgtcccaggaggagataaaccgcctgctggtggagctggcggcggaccacccccacgtg
gtgcgcctcaaggggggggaccccttcgtgttcggccgggggggcgaggaggcccaggag
ctggaccgtcacgggataccctggcgggcggtcccgggggtgaccgccgccctggggggc
ctgctgaaggaggggatcccggttacccaccggggggccgcatcggcggtgtgccttgcc
accggccacctggaggccccctccgagtcctactgggggtccctggcccggttcgatgga
agccgggtgctgtacatgtccgcatcgaacctgccagagaacctggggcgcctaatatcc
ctggggcttccggagaacgagccgtgcgtggcggtgacctgggggggctggggcaggagc
tacgtcgtggggggcaccgccggggagggggcccgagggggctgggcgtcccaggtccgg
agcccatcggtggtgatgatcggtggttccgcccgagtgaggctcacccccgcggagctg
ccactcaaggggctcaccgtggcggtctgccggcccatgccggaggggtaccagaccgcc
cggcggctggaggccctgggggcggatgcgttcaccctcccgttgctggaggtgaggccc
accgcctcccgggaggagctgcttgcatccctggagggggcggacacggtggtcttcacc
agcccaagggggcccaaggtcttcagggacctggtgatggaccttaggctcctccggtgc
cggaccgtggccatcggagaggggacccgcaggtccctggaggagatgggcataggggtg
gaccttatgccggagcgggcggacagccggtccttggcggagcttttggtgtcctgcgtg
cgccccggggagaggatcctgttccttcggaaccggcggtgctcccccctgccggtggag
gcggtccgccgggctggtgccctggctttggagctgcccatttacgagatggtcccccgt
ggtctgccctggcgggagctgatactggagcactggcaggacacgaggccccatgcggtg
gtgttcggcagcgccgccctggcggaggcctttgcggatgagttcggcccccttcccgcc
ggggcggtgccggtggcgtggggtgaggagtgcgccaagcggtgtggggagctcttccgc
cgccggggggtcgtcatggcctcccaggaccttgatggtctggtatcggccctgttggag
ataagggggagcgagcatccccctaagcatcgtggaaggggatga

DBGET integrated database retrieval system