KEGG   Thermanaerovibrio acidaminovorans: Taci_0043Help
Entry
Taci_0043         CDS       T01129                                 

Definition
(RefSeq) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00860  Porphyrin and chlorophyll metabolism
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01120  Microbial metabolism in diverse environments
Module
tai_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Taci_0043
Enzymes [BR:tai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Taci_0043
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Taci_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-GeneID: 8629853
NCBI-ProteinID: YP_003316565
UniProt: D1B7N0
Position
complement(51982..53466)
Genome map
AA seq 494 aa AA seqDB search
MIWLTGGGCASPRWLTQEGAEALGSASAVVYDRLIHPDLLLLCPPGALFIQAGKRGSDHT
MSQEEINRLLVELAADHPHVVRLKGGDPFVFGRGGEEAQELDRHGIPWRAVPGVTAALGG
LLKEGIPVTHRGAASAVCLATGHLEAPSESYWGSLARFDGSRVLYMSASNLPENLGRLIS
LGLPENEPCVAVTWGGWGRSYVVGGTAGEGARGGWASQVRSPSVVMIGGSARVRLTPAEL
PLKGLTVAVCRPMPEGYQTARRLEALGADAFTLPLLEVRPTASREELLASLEGADTVVFT
SPRGPKVFRDLVMDLRLLRCRTVAIGEGTRRSLEEMGIGVDLMPERADSRSLAELLVSCV
RPGERILFLRNRRCSPLPVEAVRRAGALALELPIYEMVPRGLPWRELILEHWQDTRPHAV
VFGSAALAEAFADEFGPLPAGAVPVAWGEECAKRCGELFRRRGVVMASQDLDGLVSALLE
IRGSEHPPKHRGRG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatatggctgacagggggcggctgtgcctccccccggtggctaacccaggagggggcg
gaggccctggggtccgcatcggcggtggtctacgaccggctgatccacccggacctgctt
ctcctctgcccccccggggccctgttcatccaggcggggaagcggggctcggaccacacc
atgtcccaggaggagataaaccgcctgctggtggagctggcggcggaccacccccacgtg
gtgcgcctcaaggggggggaccccttcgtgttcggccgggggggcgaggaggcccaggag
ctggaccgtcacgggataccctggcgggcggtcccgggggtgaccgccgccctggggggc
ctgctgaaggaggggatcccggttacccaccggggggccgcatcggcggtgtgccttgcc
accggccacctggaggccccctccgagtcctactgggggtccctggcccggttcgatgga
agccgggtgctgtacatgtccgcatcgaacctgccagagaacctggggcgcctaatatcc
ctggggcttccggagaacgagccgtgcgtggcggtgacctgggggggctggggcaggagc
tacgtcgtggggggcaccgccggggagggggcccgagggggctgggcgtcccaggtccgg
agcccatcggtggtgatgatcggtggttccgcccgagtgaggctcacccccgcggagctg
ccactcaaggggctcaccgtggcggtctgccggcccatgccggaggggtaccagaccgcc
cggcggctggaggccctgggggcggatgcgttcaccctcccgttgctggaggtgaggccc
accgcctcccgggaggagctgcttgcatccctggagggggcggacacggtggtcttcacc
agcccaagggggcccaaggtcttcagggacctggtgatggaccttaggctcctccggtgc
cggaccgtggccatcggagaggggacccgcaggtccctggaggagatgggcataggggtg
gaccttatgccggagcgggcggacagccggtccttggcggagcttttggtgtcctgcgtg
cgccccggggagaggatcctgttccttcggaaccggcggtgctcccccctgccggtggag
gcggtccgccgggctggtgccctggctttggagctgcccatttacgagatggtcccccgt
ggtctgccctggcgggagctgatactggagcactggcaggacacgaggccccatgcggtg
gtgttcggcagcgccgccctggcggaggcctttgcggatgagttcggcccccttcccgcc
ggggcggtgccggtggcgtggggtgaggagtgcgccaagcggtgtggggagctcttccgc
cgccggggggtcgtcatggcctcccaggaccttgatggtctggtatcggccctgttggag
ataagggggagcgagcatccccctaagcatcgtggaaggggatga

DBGET integrated database retrieval system