KEGG   Thermanaerovibrio acidaminovorans: Taci_0043Help
Entry
Taci_0043         CDS       T01129                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Taci_0043
Enzymes [BR:tai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Taci_0043
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Taci_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51982..53466)
Genome map
AA seq 494 aa AA seqDB search
MIWLTGGGCASPRWLTQEGAEALGSASAVVYDRLIHPDLLLLCPPGALFIQAGKRGSDHT
MSQEEINRLLVELAADHPHVVRLKGGDPFVFGRGGEEAQELDRHGIPWRAVPGVTAALGG
LLKEGIPVTHRGAASAVCLATGHLEAPSESYWGSLARFDGSRVLYMSASNLPENLGRLIS
LGLPENEPCVAVTWGGWGRSYVVGGTAGEGARGGWASQVRSPSVVMIGGSARVRLTPAEL
PLKGLTVAVCRPMPEGYQTARRLEALGADAFTLPLLEVRPTASREELLASLEGADTVVFT
SPRGPKVFRDLVMDLRLLRCRTVAIGEGTRRSLEEMGIGVDLMPERADSRSLAELLVSCV
RPGERILFLRNRRCSPLPVEAVRRAGALALELPIYEMVPRGLPWRELILEHWQDTRPHAV
VFGSAALAEAFADEFGPLPAGAVPVAWGEECAKRCGELFRRRGVVMASQDLDGLVSALLE
IRGSEHPPKHRGRG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatatggctgacagggggcggctgtgcctccccccggtggctaacccaggagggggcg
gaggccctggggtccgcatcggcggtggtctacgaccggctgatccacccggacctgctt
ctcctctgcccccccggggccctgttcatccaggcggggaagcggggctcggaccacacc
atgtcccaggaggagataaaccgcctgctggtggagctggcggcggaccacccccacgtg
gtgcgcctcaaggggggggaccccttcgtgttcggccgggggggcgaggaggcccaggag
ctggaccgtcacgggataccctggcgggcggtcccgggggtgaccgccgccctggggggc
ctgctgaaggaggggatcccggttacccaccggggggccgcatcggcggtgtgccttgcc
accggccacctggaggccccctccgagtcctactgggggtccctggcccggttcgatgga
agccgggtgctgtacatgtccgcatcgaacctgccagagaacctggggcgcctaatatcc
ctggggcttccggagaacgagccgtgcgtggcggtgacctgggggggctggggcaggagc
tacgtcgtggggggcaccgccggggagggggcccgagggggctgggcgtcccaggtccgg
agcccatcggtggtgatgatcggtggttccgcccgagtgaggctcacccccgcggagctg
ccactcaaggggctcaccgtggcggtctgccggcccatgccggaggggtaccagaccgcc
cggcggctggaggccctgggggcggatgcgttcaccctcccgttgctggaggtgaggccc
accgcctcccgggaggagctgcttgcatccctggagggggcggacacggtggtcttcacc
agcccaagggggcccaaggtcttcagggacctggtgatggaccttaggctcctccggtgc
cggaccgtggccatcggagaggggacccgcaggtccctggaggagatgggcataggggtg
gaccttatgccggagcgggcggacagccggtccttggcggagcttttggtgtcctgcgtg
cgccccggggagaggatcctgttccttcggaaccggcggtgctcccccctgccggtggag
gcggtccgccgggctggtgccctggctttggagctgcccatttacgagatggtcccccgt
ggtctgccctggcgggagctgatactggagcactggcaggacacgaggccccatgcggtg
gtgttcggcagcgccgccctggcggaggcctttgcggatgagttcggcccccttcccgcc
ggggcggtgccggtggcgtggggtgaggagtgcgccaagcggtgtggggagctcttccgc
cgccggggggtcgtcatggcctcccaggaccttgatggtctggtatcggccctgttggag
ataagggggagcgagcatccccctaagcatcgtggaaggggatga

DBGET integrated database retrieval system