KEGG   Thermanaerovibrio acidaminovorans: Taci_0101Help
Entry
Taci_0101         CDS       T01129                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Taci_0101
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Taci_0101
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Taci_0101
Enzymes [BR:tai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Taci_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(110296..111492)
Genome map
AA seq 398 aa AA seqDB search
MRNHAETETRRGYFGEYGGAFVDGSIGSRLKELDQAFLDALEDPSFQQELTDLLRRYVGR
PSALTFCANLSSRLGRGARLYLKREDLNHTGAHKINNALGQGLLARRMGKKEIIAETGAG
MHGTACATVAALLGLECTVFMGSQDVQRQAANVARMKALGARVVSVSQGDGTLKEAVDAA
LHEYASNPQAFYLLGSVVGPHPYPTMVRHFQSVIGHEAREQFLKEEGRLPHYAVACVGGG
SNAMGLFSAFTDDLDVKLIAVEPAGKGLDSGLHAASLMRGEPAIIHGFKTYVITDPNGNP
GRVHSISSGLDYPGVGPELAHLKDMGRISCEGVTDQEALDGFLALSRHEGIIPALESAHA
VAFAMKLLPTLSDGTTVLVNLSGRGDKDLNTVMRELEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccatgcggagaccgagaccaggcgaggctacttcggggagtacgggggggca
ttcgtggacggatccatcggatccaggctgaaggagctcgatcaggcctttctagatgcc
ctggaagatccgtcgttccagcaggagctcacagacctgctccggcgctacgttgggagg
ccctcggcccttacgttctgcgccaacctgtccagccgcctgggcaggggggccaggctg
tacctcaagcgggaggacctgaaccacaccggagcccacaagataaacaatgccctggga
cagggtttgctcgcccgtcggatggggaagaaggagatcatcgccgagaccggggcaggt
atgcacggcaccgcctgcgccaccgtggcagccctcctggggcttgagtgcaccgtcttc
atgggctcccaggacgtccagcgccaggccgcaaacgtggccaggatgaaggccctgggg
gcccgggtggtgagcgtctcccagggggacgggaccctcaaggaggcggtggacgcggcc
ctccatgagtacgcttccaacccccaggccttctacctcctggggtccgtggtgggcccc
catccctaccccaccatggtgcgccacttccagtccgtgataggccacgaggcccgggag
cagttcctgaaggaggaggggcggctcccccactacgcggtggcctgcgtgggagggggc
agcaacgccatggggctattcagcgccttcacggacgacctggacgttaagctcatcgcg
gtggaacccgccggcaaagggctcgattcagggctccacgccgcctccctcatgaggggg
gaaccggcgatcatccacggcttcaagacctacgtgatcaccgacccaaacgggaaccca
ggccgggttcacagcatatcctcgggcctggactacccgggggttggacccgagctggcg
cacctcaaggacatgggccgcatatcctgtgaaggggtcaccgaccaggaggccctagat
ggcttcttggccctctcaaggcacgaaggcataatacccgccctagaaagcgcccatgcg
gtggccttcgccatgaaactgctacccaccctcagcgatggcaccaccgtgctggtgaac
ctctccggccggggggacaaggacctcaacacggtcatgagggagctggaactatag

DBGET integrated database retrieval system